DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11753 and sys1

DIOPT Version :9

Sequence 1:NP_649809.1 Gene:CG11753 / 41023 FlyBaseID:FBgn0037603 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_956304.2 Gene:sys1 / 336339 ZFINID:ZDB-GENE-030131-8283 Length:156 Species:Danio rerio


Alignment Length:148 Identity:65/148 - (43%)
Similarity:91/148 - (61%) Gaps:2/148 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FRNTQWDPTLLSSQIVSMQFCVYFT-LGLLVFVANKLSGDNYSLDHLFEYHEIHIYDMGGRLVIC 69
            ||:..|||.|:.||||.|| |:|:: |||.:...:.|...:.|||.:|.|..:......|||.:.
Zfish     5 FRSYVWDPVLIISQIVLMQ-CIYYSFLGLWLAGVDGLVQTSRSLDQIFSYEVLGFSTTHGRLSMM 68

  Fly    70 AFVLNAFLASLALWCIVRRAKLCLDFSCTFHVLHLLICWWYNRSFPANASWWLLNVITGTIMCIG 134
            ||:||:...:..||..:||.|.||||:.|.|..|::.||.||...||..||||:||....:|.:.
Zfish    69 AFILNSLTCAFGLWFFIRRGKQCLDFTVTVHFFHMIGCWIYNAHLPAALSWWLVNVACMALMAVI 133

  Fly   135 GEFLCLQTEMKEIPVGYA 152
            ||:||::||::.|||..|
Zfish   134 GEYLCMRTELRAIPVNTA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11753NP_649809.1 SYS1 6..149 CDD:370705 62/143 (43%)
sys1NP_956304.2 SYS1 5..148 CDD:286839 62/143 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576012
Domainoid 1 1.000 131 1.000 Domainoid score I5150
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H43135
Inparanoid 1 1.050 133 1.000 Inparanoid score I4590
OMA 1 1.010 - - QHG55603
OrthoDB 1 1.010 - - D1583277at2759
OrthoFinder 1 1.000 - - FOG0006601
OrthoInspector 1 1.000 - - oto41415
orthoMCL 1 0.900 - - OOG6_103385
Panther 1 1.100 - - LDO PTHR12952
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2304
SonicParanoid 1 1.000 - - X4838
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.