DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11753 and AT1G79985

DIOPT Version :9

Sequence 1:NP_649809.1 Gene:CG11753 / 41023 FlyBaseID:FBgn0037603 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001117624.4 Gene:AT1G79985 / 28717438 AraportID:AT1G79985 Length:152 Species:Arabidopsis thaliana


Alignment Length:139 Identity:47/139 - (33%)
Similarity:78/139 - (56%) Gaps:1/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WDPTLLSSQIVSMQFCVYFTLGLLVFVANKLSGDNYSLDHLFEYHEIHIYDMGGRLVICAFVLNA 75
            |||.|:..||:.:|...|.||||...|...|.....||.:.|:|..:......|..||.:|:.::
plant     8 WDPWLIVGQIICLQCSYYLTLGLFTMVFLGLRVPRLSLVYFFDYATLTTSTFTGWSVIASFLFSS 72

  Fly    76 FLASLALWCIVRRAKLCLDFSCTFHVLHLLICWWYNRSFPANASWWLLNVITGTIMCIGGEFLCL 140
            ...::.:..:|.||:.|||||.|.:::||..|..|. .:|::.:||::|.....:|.:..|:||:
plant    73 LAGAVYMIFLVERARKCLDFSATLYIIHLFFCIMYG-GWPSSMAWWVVNGTGLAVMALLAEYLCI 136

  Fly   141 QTEMKEIPV 149
            :.|.:|||:
plant   137 KREQREIPM 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11753NP_649809.1 SYS1 6..149 CDD:370705 46/137 (34%)
AT1G79985NP_001117624.4 SYS1 3..145 CDD:370705 46/137 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I2437
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I2209
OMA 1 1.010 - - QHG55603
OrthoDB 1 1.010 - - D1583277at2759
OrthoFinder 1 1.000 - - FOG0006601
OrthoInspector 1 1.000 - - oto3862
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12952
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4838
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.