DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11753 and T03F1.12

DIOPT Version :9

Sequence 1:NP_649809.1 Gene:CG11753 / 41023 FlyBaseID:FBgn0037603 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001021606.1 Gene:T03F1.12 / 171969 WormBaseID:WBGene00020193 Length:148 Species:Caenorhabditis elegans


Alignment Length:147 Identity:50/147 - (34%)
Similarity:78/147 - (53%) Gaps:16/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TFRNTQWDPTLLSSQIVSMQFCVYFT-LGLLVFVANKLSGDNYSLDHLFEYHEI--HIYDM-GGR 65
            :||...|||.||.||:..:|...|.| ..:::|.:            .|.|..:  .|:.: ..|
 Worm     3 SFRQFVWDPVLLVSQMTCLQTFFYATQTSVMLFCS------------FFGYEPLISSIFSIQTQR 55

  Fly    66 LVICAFVLNAFLASLALWCIVRRAKLCLDFSCTFHVLHLLICWWYNRSFPANASWWLLNVITGTI 130
            .:....:::|...|.||..:|:|||.||||:||.|..||:....||.:.|...:||:|.||:.|:
 Worm    56 SMALIQLVSAVGVSFALSHLVQRAKQCLDFACTVHFFHLIFTTIYNHALPTQFTWWILQVISTTV 120

  Fly   131 MCIGGEFLCLQTEMKEI 147
            ..:.||:||::.|.:||
 Worm   121 CTVLGEYLCMRIESQEI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11753NP_649809.1 SYS1 6..149 CDD:370705 50/146 (34%)
T03F1.12NP_001021606.1 SYS1 4..139 CDD:286839 50/146 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157492
Domainoid 1 1.000 84 1.000 Domainoid score I5307
eggNOG 1 0.900 - - E1_KOG4697
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H43135
Inparanoid 1 1.050 85 1.000 Inparanoid score I3742
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55603
OrthoDB 1 1.010 - - D1583277at2759
OrthoFinder 1 1.000 - - FOG0006601
OrthoInspector 1 1.000 - - oto19856
orthoMCL 1 0.900 - - OOG6_103385
Panther 1 1.100 - - LDO PTHR12952
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2304
SonicParanoid 1 1.000 - - X4838
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.