DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhod and CG9674

DIOPT Version :9

Sequence 1:NP_477224.1 Gene:Dhod / 41022 FlyBaseID:FBgn0000447 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001246804.1 Gene:CG9674 / 39878 FlyBaseID:FBgn0036663 Length:2115 Species:Drosophila melanogaster


Alignment Length:315 Identity:67/315 - (21%)
Similarity:111/315 - (35%) Gaps:80/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IEVGTVTPAAQEGNPKPRVFRLTEDKAIINRY-----GFNS---DGHQAVLQRLRLLRKKENFNG 179
            |::..|.||::                |:.|:     .|.|   :.||.:...:..:..|.| .|
  Fly   939 IDISEVEPASE----------------IVKRFATGAMSFGSISLEAHQTLSITMNRIGGKSN-TG 986

  Fly   180 VVG------VNLGRNKTTMSPIADYVQGVRVFGPVADYLVINVSSPNTK---GLRDMQSKEKLRE 235
            ..|      :|...|.:..|.|.....|  .||..|.||. |......|   |.:..:..|    
  Fly   987 EGGEDSDRYLNQDPNNSRRSAIKQVASG--RFGVTASYLA-NADDLQIKMAQGAKPGEGGE---- 1044

  Fly   236 LLEQVNDTKSSLDKNKNVPILLKLSP----DL-SLDDMKDIVWVIK--RKKSRVDGLIVSNTTVS 293
             |.....||......|:||.:..:||    |: |::|:.::::.:|  ...:|:...:||...|.
  Fly  1045 -LPGYKVTKDIAKTRKSVPGVGLISPPPHHDIYSIEDLAELIYDLKCSNPNARISVKLVSEVGVG 1108

  Fly   294 --RENIEKNKLAEE---------TGGLSGPPLKARSTEM---IAQMYQL-----TDGKIPIIGVG 339
              ...:.|.| ||.         ||..|...:|......   :|:.:|:     ...::.:...|
  Fly  1109 VVASGVAKGK-AEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLVLNNLRSRVIVQADG 1172

  Fly   340 GVASGYDAYEKIEAGASYVQIYTALVYEGPALVEDIKAELSALITRLGHTNVADV 394
            .:.:|:|.......||......||     |.:|      :...:.|..|.|...|
  Fly  1173 QLRTGFDVVVAALLGADEFGFSTA-----PLIV------MGCTMMRKCHLNTCPV 1216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhodNP_477224.1 PRK05286 45..387 CDD:235388 64/306 (21%)
DHOD_2_like 51..379 CDD:240089 63/298 (21%)
CG9674NP_001246804.1 gltB 75..1565 CDD:236968 67/315 (21%)
GATase_2 88..504 CDD:278726
Glu_syn_central 543..828 CDD:282720
GltS_FMN 918..1271 CDD:239202 67/315 (21%)
gltB_C 1316..1565 CDD:238482
gltD 1623..2106 CDD:237213
Fer4_8 1645..1756 CDD:302761
NAD_binding_8 1772..>1804 CDD:290186
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.