DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhod and dare

DIOPT Version :9

Sequence 1:NP_477224.1 Gene:Dhod / 41022 FlyBaseID:FBgn0000447 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_477150.1 Gene:dare / 36203 FlyBaseID:FBgn0015582 Length:466 Species:Drosophila melanogaster


Alignment Length:166 Identity:36/166 - (21%)
Similarity:65/166 - (39%) Gaps:41/166 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 TMSPIADYVQGVRVFGPVADYLVINVSSPNTKGLRDMQSK----------------EKLRELLEQ 239
            |.:..|::.: :|.||        |:|......||:::.:                |...|.|:.
  Fly    87 TFTKTAEHPR-LRYFG--------NISLGTDVSLRELRDRYHAVLLTYGADQDRQLELENEQLDN 142

  Fly   240 VNDTKSSLDKNKNVPILLKLSPDLSLDDMKDI------VWVIKRKKSRVDGLIVSNTT------V 292
            |...:..:.....:|....|:||||..|:..:      |.|.:...|.:|.|..::||      :
  Fly   143 VISARKFVAWYNGLPGAENLAPDLSGRDVTIVGQGNVAVDVARMLLSPLDALKTTDTTEYALEAL 207

  Fly   293 SRENIEKNKLAEETGGLSGPPLKARSTEMIAQMYQL 328
            |...:|:..|.    |..||...|.:.:.:.:|.:|
  Fly   208 SCSQVERVHLV----GRRGPLQAAFTIKELREMLKL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhodNP_477224.1 PRK05286 45..387 CDD:235388 36/166 (22%)
DHOD_2_like 51..379 CDD:240089 36/166 (22%)
dareNP_477150.1 PLN02852 10..465 CDD:215457 36/166 (22%)
NAD_binding_8 34..98 CDD:290186 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445081
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.