DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhod and dpyd-1

DIOPT Version :9

Sequence 1:NP_477224.1 Gene:Dhod / 41022 FlyBaseID:FBgn0000447 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_508927.2 Gene:dpyd-1 / 180818 WormBaseID:WBGene00016103 Length:1059 Species:Caenorhabditis elegans


Alignment Length:348 Identity:76/348 - (21%)
Similarity:140/348 - (40%) Gaps:84/348 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 DDQNLHTSFFGRMLSNPIGIAA------------GFDKNAEAVDGLQDLGFGFIEVGT------- 127
            |:.::.....|....||.|:|:            .|::           |:|||...|       
 Worm   543 DEVDISVDMCGVKFENPFGLASAPPTTSGPMCRRAFEQ-----------GWGFILTKTYGLDKDL 596

  Fly   128 VTPAAQEGNPKPRVFRLTEDKAIINRYGFNSDGHQAV-----------LQRLRLLRKKENFNGVV 181
            ||      |..||:.|.:....:   ||.|......:           ||.:|.|::......|:
 Worm   597 VT------NVSPRIVRGSTSGPL---YGPNQGSFMNIELISEKSCEYWLQCIRELKRDHPTKIVI 652

  Fly   182 -GVNLGRNKTTMSPIADYVQ-GVRVFGPVADYLVINVSSPNTKGLRDM-----QSKEKLRELLEQ 239
             .:....||      ||::: ..:.....||.|.:|:|.|:..|.:.|     ||.|.::|:...
 Worm   653 ASIMCVYNK------ADWIELATKSEEAGADILELNLSCPHGMGEKGMGLACGQSPEIVKEICRW 711

  Fly   240 VNDTKSSLDKNKNVPILLKLSPDLSLDDMKDIVWVIKRKKSRVDGLIVSNTTVSRENIEKNKLA- 303
            |...       ..:|...|::|:::  |:::|...  .:.....|:..:||..|..:::.:..| 
 Worm   712 VRAC-------VKIPFFPKMTPNIT--DVREIARA--ARDGGASGVTATNTVSSLMHMKADGNAW 765

  Fly   304 ------EET--GGLSGPPLKARSTEMIAQMYQLTDGKIPIIGVGGVASGYDAYEKIEAGASYVQI 360
                  :.|  ||:||..::..:.:.::.:....|| .||:..||:.|.......:.||||.:|:
 Worm   766 PAIGSTKRTTYGGMSGSAIRPIAMKAVSSIANELDG-FPIMATGGIESAETGLGFLMAGASVLQV 829

  Fly   361 YTALVYEGPALVEDIKAELSALI 383
            .:|:..:...:|:|....|.||:
 Worm   830 CSAVQNQDFTVVDDYCTGLKALL 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhodNP_477224.1 PRK05286 45..387 CDD:235388 76/348 (22%)
DHOD_2_like 51..379 CDD:240089 73/342 (21%)
dpyd-1NP_508927.2 PRK11749 69..523 CDD:236967
Fer4_20 71..183 CDD:291363
NAD_binding_8 206..>251 CDD:290186
PRK08318 546..1019 CDD:236237 75/345 (22%)
DHPD_FMN 546..848 CDD:239244 72/339 (21%)
Fer4_9 964..1009 CDD:289930
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0167
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.