DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP2 and NGR1

DIOPT Version :10

Sequence 1:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_009771.3 Gene:NGR1 / 852513 SGDID:S000000416 Length:672 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:24/78 - (30%)
Similarity:36/78 - (46%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YKLFVGNLPWTIGSKELRTYF-SKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSA-SNQNT 72
            :.||||:|..|....:|.:.| :::..|....|:.|...|.|:.:|||.|...|....| ...:.
Yeast   192 FSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALIEMSG 256

  Fly    73 HFLDGRVLTVQRA 85
            .:..||.|.|..|
Yeast   257 KWFQGRALRVAYA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 22/73 (30%)
NGR1NP_009771.3 RRM1_NGR1_NAM8_like 35..180 CDD:410023
RRM2_NGR1_NAM8_like 191..270 CDD:410025 24/78 (31%)
RRM3_NGR1_NAM8_like 359..430 CDD:409782
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.