DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP2 and LIF2

DIOPT Version :10

Sequence 1:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_567192.1 Gene:LIF2 / 827998 AraportID:AT4G00830 Length:495 Species:Arabidopsis thaliana


Alignment Length:57 Identity:19/57 - (33%)
Similarity:30/57 - (52%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSA 67
            ::|:|.||..:|.::||....:.|.:....::.||..|.||.|.||.|..:|....|
plant   117 EVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 19/57 (33%)
LIF2NP_567192.1 hnRNP-R-Q 112..>430 CDD:273732 19/57 (33%)

Return to query results.
Submit another query.