DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP2 and TBPH

DIOPT Version :10

Sequence 1:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:75 Identity:30/75 - (40%)
Similarity:37/75 - (49%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQNTHFLD 76
            |.|..|||....:.||.||..||.|..|::..|.:.|.||.:|||.|...|| ......|.|.:|
  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDA-QMRVLTNRHLID 172

  Fly    77 GRVLTVQRAN 86
            ||...|:..|
  Fly   173 GRWCEVKVPN 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 28/70 (40%)
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 29/72 (40%)
RRM2_TDP43 192..261 CDD:409761
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.