DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP2 and HNRNPD

DIOPT Version :10

Sequence 1:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_112738.1 Gene:HNRNPD / 3184 HGNCID:5036 Length:355 Species:Homo sapiens


Alignment Length:79 Identity:28/79 - (35%)
Similarity:48/79 - (60%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RSSYKLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQN 71
            |..:|:|:|.|.|....|:|:.||||:|.|.:..:..|...|.|:.:|||:|.:.::.:...:|.
Human    94 REEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQK 158

  Fly    72 THFLDGRVLTVQRA 85
            .|.|:|:|:..:||
Human   159 EHKLNGKVIDPKRA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 25/71 (35%)
HNRNPDNP_112738.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92
CBFNT <60..78 CDD:311868
RRM1_hnRNPD 99..172 CDD:410150 24/72 (33%)
RRM2_hnRNPD 183..257 CDD:241027
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.