DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP2 and HNRNPA3

DIOPT Version :10

Sequence 1:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_919223.1 Gene:HNRNPA3 / 220988 HGNCID:24941 Length:378 Species:Homo sapiens


Alignment Length:75 Identity:26/75 - (34%)
Similarity:37/75 - (49%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQNTHFL 75
            |:|||.:........||.||.|||.:...||:.|||.|..:.:.||.|...|..:....|..|.:
Human   127 KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTI 191

  Fly    76 DGRVLTVQRA 85
            :|....|::|
Human   192 NGHNCEVKKA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 24/71 (34%)
HNRNPA3NP_919223.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
RRM1_hnRNPA_like 36..113 CDD:409992
RRM2_hnRNPA3 126..205 CDD:409996 26/75 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..225
HnRNPA1 331..>347 CDD:463312
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..378
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.