DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP2 and Msi1

DIOPT Version :10

Sequence 1:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_032655.1 Gene:Msi1 / 17690 MGIID:107376 Length:362 Species:Mus musculus


Alignment Length:70 Identity:22/70 - (31%)
Similarity:35/70 - (50%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQNTHFL 75
            |:|:|.|.|....:.||.||.::|.|....|:.|.....|:.:|||.|..:...:....|:.|.|
Mouse    21 KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHEL 85

  Fly    76 DGRVL 80
            |.:.:
Mouse    86 DSKTI 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 22/70 (31%)
Msi1NP_032655.1 RRM1_MSI 21..96 CDD:409990 22/70 (31%)
PABP-1234 <32..312 CDD:130689 17/59 (29%)
RRM2_MSI 110..183 CDD:240769
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.