DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and MKK9

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_177492.1 Gene:MKK9 / 843685 AraportID:AT1G73500 Length:310 Species:Arabidopsis thaliana


Alignment Length:373 Identity:103/373 - (27%)
Similarity:163/373 - (43%) Gaps:87/373 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NLSIRHPPSSTSSTSSGSTSSGSSSSSQHNHVTRCFGAQQPQQTPPVASSQVPPVPAASSSSAAD 91
            ||.:..||.|....|:.|:|:.:::.:..|.::.|                              
plant    11 NLRLPLPPISDRRFSTSSSSATTTTVAGCNGISAC------------------------------ 45

  Fly    92 RHRERIRQQACGKLQFGEGGANTHTFTSDDLEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRST 156
                                         |||....:|.|..|.|.|:..|...::.|:|.:...
plant    46 -----------------------------DLEKLNVLGCGNGGIVYKVRHKTTSEIYALKTVNGD 81

  Fly   157 VDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFKE--GDCWICMELMDTSLDKFYKYIYEKQQRH 219
            :|....:||:.::| :::..:..|:|:.:|...|.  |:..|.||.||..       ..|..:..
plant    82 MDPIFTRQLMREME-ILRRTDSPYVVKCHGIFEKPVVGEVSILMEYMDGG-------TLESLRGG 138

  Fly   220 IPESILAKITVATVNALNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKD- 283
            :.|..||......:..|:|| ..|||:|||:||:|:||:.:.::|:.|||:|..||.|:..... 
plant   139 VTEQKLAGFAKQILKGLSYL-HALKIVHRDIKPANLLLNSKNEVKIADFGVSKILVRSLDSCNSY 202

  Fly   284 AGCRPYMAPERIDPERAKG-YDV-RSDVWSLGITLMEVATGNFPY------RKWDSVFEQLCQVV 340
            .|...||:|||.|.|.:.| .|: ..|:||.|:.::|:..|:||.      ..|.::   :|.|.
plant   203 VGTCAYMSPERFDSESSGGSSDIYAGDIWSFGLMMLELLVGHFPLLPPGQRPDWATL---MCAVC 264

  Fly   341 QGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFIR 388
            .|||||   :..|.  |:||..||..||.|..|.|....:||..||:|
plant   265 FGEPPR---APEGC--SEEFRSFVECCLRKDSSKRWTAPQLLAHPFLR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 93/285 (33%)
S_TKc 123..387 CDD:214567 89/274 (32%)
MKK9NP_177492.1 PKc_MAPKK_plant_like 46..308 CDD:132954 93/279 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.