DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and MKK6

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_200469.1 Gene:MKK6 / 835759 AraportID:AT5G56580 Length:356 Species:Arabidopsis thaliana


Alignment Length:358 Identity:109/358 - (30%)
Similarity:178/358 - (49%) Gaps:45/358 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PQQTPPVASSQVPPVPAASSSSAAD-----------RHRERIRQQACGKLQFGEGGANTHTFTSD 120
            |.|..|::|.    :.|:.:....|           ...::.||....:|.|        ..|::
plant    16 PAQESPISSF----LTASGTFHDGDFLLNQKGLRLTSDEKQSRQSDSKELDF--------EITAE 68

  Fly   121 DLEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFY 185
            |||....||:|:.|.|..:..|.:.|..|:|.|:..:.|:.:||::.:|::...|::|.::|..|
plant    69 DLETVKVIGKGSGGVVQLVRHKWVGKFFAMKVIQMNIQEEIRKQIVQELKINQASSQCPHVVVCY 133

  Fly   186 GALFKEGDCWICMELMDT-SLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRD 249
            .:.:..|...:.:|.||. ||....     :|.:.|.|..||.:....:..|.||..|..:||||
plant   134 HSFYHNGAFSLVLEYMDRGSLADVI-----RQVKTILEPYLAVVCKQVLLGLVYLHNERHVIHRD 193

  Fly   250 VKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKD--AGCRPYMAPERIDPERAKGYDVRSDVWSL 312
            :||||:|::.:|::|:.|||:|..|..|:.: :|  .|...||:||||.   ...||..||:|||
plant   194 IKPSNLLVNHKGEVKISDFGVSASLASSMGQ-RDTFVGTYNYMSPERIS---GSTYDYSSDIWSL 254

  Fly   313 GITLMEVATGNFPYRKWD------SVFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKK 371
            |::::|.|.|.|||.:.:      |.:|.|..:|:..||...:.    :||.||..||:.|:.|.
plant   255 GMSVLECAIGRFPYLESEDQQNPPSFYELLAAIVENPPPTAPSD----QFSPEFCSFVSACIQKD 315

  Fly   372 ESDRPKYSRLLEMPFIRRGETSHTDVAVYVADI 404
            ...|.....||..|||::.|....|:.:.|..:
plant   316 PPARASSLDLLSHPFIKKFEDKDIDLGILVGTL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 99/299 (33%)
S_TKc 123..387 CDD:214567 91/272 (33%)
MKK6NP_200469.1 PKc_MAPKK_plant_like 68..335 CDD:132954 95/279 (34%)
S_TKc 71..331 CDD:214567 91/272 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.