DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and MKK3

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001318713.1 Gene:MKK3 / 834042 AraportID:AT5G40440 Length:520 Species:Arabidopsis thaliana


Alignment Length:309 Identity:98/309 - (31%)
Similarity:153/309 - (49%) Gaps:23/309 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 EGGANTHTFTSDDLEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVM 173
            |....|:...|.::...|.||.||...|.:.......:::|:|:|.....||.| |||.::..:.
plant    70 ESSETTYQCASHEMRVFGAIGSGASSVVQRAIHIPNHRILALKKINIFEREKRQ-QLLTEIRTLC 133

  Fly   174 KSNECIYIVQFYGALFK--EGDCWICMELMD-TSLDKFYKYIYEKQQRHIPESILAKITVATVNA 235
            ::.....:|.|:||.:.  .|...|.:|.|: .||....|.     .:.|||.:|:.:....:..
plant   134 EAPCHEGLVDFHGAFYSPDSGQISIALEYMNGGSLADILKV-----TKKIPEPVLSSLFHKLLQG 193

  Fly   236 LNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKD-AGCRPYMAPERIDPER 299
            |:||.....::|||:||:|:|::.:|:.|:.|||||..|.:|:|.... .|...||:||||   |
plant   194 LSYLHGVRHLVHRDIKPANLLINLKGEPKITDFGISAGLENSMAMCATFVGTVTYMSPERI---R 255

  Fly   300 AKGYDVRSDVWSLGITLMEVATGNFPYRKWDSVFEQLCQVVQG---EPPRLLTSYNGMEFSKEFV 361
            ...|...:|:||||:.|.|..||.|||...:.....:.|::..   .||:       .|||.||.
plant   256 NDSYSYPADIWSLGLALFECGTGEFPYIANEGPVNLMLQILDDPSPTPPK-------QEFSPEFC 313

  Fly   362 DFVNTCLIKKESDRPKYSRLLEMPFIRRGETSHTDVAVYVADILESMEK 410
            .|::.||.|....||...:||..|||.:.|....|:|.:|..|.:..::
plant   314 SFIDACLQKDPDARPTADQLLSHPFITKHEKERVDLATFVQSIFDPTQR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 95/296 (32%)
S_TKc 123..387 CDD:214567 88/270 (33%)
MKK3NP_001318713.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48013
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.