DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and MKK2

DIOPT Version :10

Sequence 1:NP_477353.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001031751.1 Gene:MKK2 / 829103 AraportID:AT4G29810 Length:372 Species:Arabidopsis thaliana


Alignment Length:56 Identity:12/56 - (21%)
Similarity:22/56 - (39%) Gaps:10/56 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PFLPGLNPNGQIILRRLNTDPGNEELDEHLVEWLMRVQGERLDEQRSELP-PIKPE 61
            |.:.|:...|:.:.         |.:|..|...::|:.....|...:..| |:.||
plant   139 PIIAGIGSLGENLC---------EFIDHFLQPLVLRLPSYLRDSVNNHYPLPLIPE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_477353.1 PKc_MKK4 115..405 CDD:270790
MKK2NP_001031751.1 PKc_MAPKK 77..344 CDD:270782 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.