DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and MEK1

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_194337.1 Gene:MEK1 / 828713 AraportID:AT4G26070 Length:354 Species:Arabidopsis thaliana


Alignment Length:322 Identity:104/322 - (32%)
Similarity:166/322 - (51%) Gaps:27/322 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RIRQQACGKLQFGEGGAN------THTFTSDDLEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIR 154
            |:.:.....:...|.||.      .:..:..|||....||:|:.|.|..:..|...:..|:|.|:
plant    36 RVNKDGIQTVSLSEPGAPPPIEPLDNQLSLADLEVIKVIGKGSSGNVQLVKHKLTQQFFALKVIQ 100

  Fly   155 STVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFKEGDCWICMELMD-TSLDKFYKYIYEKQQR 218
            ...:|...:.:..:|.:.: |::|.|:|..|.:.:..|...|.:|.|| .||....|.:.:    
plant   101 LNTEESTCRAISQELRINL-SSQCPYLVSCYQSFYHNGLVSIILEFMDGGSLADLLKKVGK---- 160

  Fly   219 HIPESILAKITVATVNALNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKD 283
             :||::|:.|....:..|.|:..|.:|||||:||||:|::.||::|:.|||:|..|..:.:....
plant   161 -VPENMLSAICKRVLRGLCYIHHERRIIHRDLKPSNLLINHRGEVKITDFGVSKILTSTSSLANS 224

  Fly   284 -AGCRPYMAPERIDPERAKGYDVRSDVWSLGITLMEVATGNFPY------RKWDSVFEQLCQVVQ 341
             .|..|||:||||.   ...|..:||:||||:.|:|.|||.|||      :.|.||:|.:..:|:
plant   225 FVGTYPYMSPERIS---GSLYSNKSDIWSLGLVLLECATGKFPYTPPEHKKGWSSVYELVDAIVE 286

  Fly   342 GEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFIRRGETSHTDVAVYVAD 403
            ..||...::.    ||.||..|::.|:.|...||.....|||..|::..|.|.|:::.|..|
plant   287 NPPPCAPSNL----FSPEFCSFISQCVQKDPRDRKSAKELLEHKFVKMFEDSDTNLSAYFTD 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 100/297 (34%)
S_TKc 123..387 CDD:214567 92/271 (34%)
MEK1NP_194337.1 PKc_MAPKK_plant_like 66..332 CDD:132954 95/278 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.