DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and MKK8

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_187274.1 Gene:MKK8 / 819797 AraportID:AT3G06230 Length:293 Species:Arabidopsis thaliana


Alignment Length:320 Identity:89/320 - (27%)
Similarity:149/320 - (46%) Gaps:53/320 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QQPQQTPPVASSQVPPVPAASSSSAADRHRERIRQQACGKLQFGEGGANTHTFTSDDLEDEGEIG 129
            |.|...||   .:.|.:||...|:..         .:|.          ::||:..:|:....:|
plant    18 QAPTTIPP---CRFPIIPATKVSATV---------SSCA----------SNTFSVANLDRISVLG 60

  Fly   130 RGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFK--EG 192
            .|..|.|.|:..|...::.|:|:::...|...    |.::|::...|. .|:.:.:. :|:  .|
plant    61 SGNGGTVFKVKDKTTSEIYALKKVKENWDSTS----LREIEILRMVNS-PYVAKCHD-IFQNPSG 119

  Fly   193 DCWICMELMDTSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSNILL 257
            :..|.|:.||....:..:.:.|||        ||.::...:...|||.|. ||:|||:||:|:|.
plant   120 EVSILMDYMDLGSLESLRGVTEKQ--------LALMSRQVLEGKNYLHEH-KIVHRDIKPANLLR 175

  Fly   258 HRRGDIKLCDFGISGQLVDSIAKTKD-AGCRPYMAPERID------PERAKGYDVRSDVWSLGIT 315
            ..:.::|:.|||:|..:|.|:.|... .|...||:|||:|      .|..|......|:||.|:|
plant   176 SSKEEVKIADFGVSKIVVRSLNKCNSFVGTFAYMSPERLDSEADGVTEEDKSNVYAGDIWSFGLT 240

  Fly   316 LMEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDR 375
            ::|:..|.:|.....:..  :|.|..||||:.     ..|.|.:...|::.||.||.|:|
plant   241 MLEILVGYYPMLPDQAAI--VCAVCFGEPPKA-----PEECSDDLKSFMDCCLRKKASER 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 80/270 (30%)
S_TKc 123..387 CDD:214567 77/262 (29%)
MKK8NP_187274.1 PKc_like 51..293 CDD:304357 77/263 (29%)
S_TKc 56..293 CDD:214567 76/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.