DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and MAP2K7

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_006722863.1 Gene:MAP2K7 / 5609 HGNCID:6847 Length:442 Species:Homo sapiens


Alignment Length:433 Identity:186/433 - (42%)
Similarity:242/433 - (55%) Gaps:59/433 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ERPKNLFATGSSRSRNPPD----QLSLNNLSIRHPPSSTSSTSSGSTSSGSSSSSQHNHVTRCFG 63
            :||:.:.....|.:..|..    ||.|.|             ..||.|..|.||.||        
Human    37 QRPRPIIVITLSPAPAPSQRAALQLPLAN-------------DGGSRSPSSESSPQH-------- 80

  Fly    64 AQQPQQTPPVASSQVPPVPA------ASSSSAADRHRERIRQQACGKLQFGEGGANTHTFTSDDL 122
                 .|||.....:..:|:      :..|...|:..:.|.:|. |.|..   |...:....:||
Human    81 -----PTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQT-GYLTI---GGQRYQAEINDL 136

  Fly   123 EDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGA 187
            |:.||:|.|..|.|.||.|:|...|:|||::|.:.:::|.|::||||:||:||::|.||||.:|.
Human   137 ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGT 201

  Fly   188 LFKEGDCWICMELMDTSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKP 252
            .....|.:|.||||.|..:|..|    :.|..|||.||.|:|||.|.||.||||:..:|||||||
Human   202 FITNTDVFIAMELMGTCAEKLKK----RMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKP 262

  Fly   253 SNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDP--ERAKGYDVRSDVWSLGIT 315
            |||||..||.||||||||||:||||.|||:.|||..|||||||||  .....||:|:|||||||:
Human   263 SNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGIS 327

  Fly   316 L-------MEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKES 373
            |       :|:|||.|||:...:.||.|.:|:|.||| ||..:.|  ||.:|..||..||.|...
Human   328 LPCPSPSQVELATGQFPYKNCKTDFEVLTKVLQEEPP-LLPGHMG--FSGDFQSFVKDCLTKDHR 389

  Fly   374 DRPKYSRLLEMPFIRRGETSHTDVAVYVADIL---ESMEKDGI 413
            .||||::|||..||:|.||...|||.:..|::   ||....|:
Human   390 KRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGV 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 156/298 (52%)
S_TKc 123..387 CDD:214567 145/272 (53%)
MAP2K7XP_006722863.1 PKc_MKK7 120..423 CDD:270791 159/312 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.