DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and MAP2K6

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_011523328.1 Gene:MAP2K6 / 5608 HGNCID:6846 Length:337 Species:Homo sapiens


Alignment Length:342 Identity:172/342 - (50%)
Similarity:223/342 - (65%) Gaps:31/342 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QQPQQTPPVASSQVPPVPAASSSSAADRHRERIRQQACGKLQFGEGGANTHTFTSDDLEDEGEIG 129
            :|||      :|..||              ..:..:||..:     |.......:||||...|:|
Human    24 EQPQ------TSSTPP--------------RDLDSKACISI-----GNQNFEVKADDLEPIMELG 63

  Fly   130 RGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFKEGDC 194
            |||:|.|.||......::|||||||:||:.:|||:|||||::.|::.:|.:.|.||||||:|||.
Human    64 RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDV 128

  Fly   195 WICMELMDTSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSNILLHR 259
            ||||||||||||||||.:.:|.|. |||.||.||.|:.|.||.:|..:|.:|||||||||:|::.
Human   129 WICMELMDTSLDKFYKQVIDKGQT-IPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINA 192

  Fly   260 RGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPE-RAKGYDVRSDVWSLGITLMEVATGN 323
            .|.:|:|||||||.||||:|||.||||:||||||||:|| ..|||.|:||:||||||::|:|...
Human   193 LGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILR 257

  Fly   324 FPYRKWDSVFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFIR 388
            |||..|.:.|:||.|||:...|:|...    :||.|||||.:.||.|...:||.|..|::.||..
Human   258 FPYDSWGTPFQQLKQVVEEPSPQLPAD----KFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFT 318

  Fly   389 RGETSHTDVAVYVADIL 405
            ..|:..||||.:|..||
Human   319 LHESKGTDVASFVKLIL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 161/290 (56%)
S_TKc 123..387 CDD:214567 151/264 (57%)
MAP2K6XP_011523328.1 PKc_MKK3_6 54..336 CDD:173729 163/287 (57%)
S_TKc 57..317 CDD:214567 151/264 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51923
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 1 1.000 - - FOG0001217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101822
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2221
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.