DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and MAP2K5

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_660143.1 Gene:MAP2K5 / 5607 HGNCID:6845 Length:448 Species:Homo sapiens


Alignment Length:410 Identity:142/410 - (34%)
Similarity:201/410 - (49%) Gaps:79/410 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKNLFATGSSRSRNPPDQLSLNNLSIRHPPSSTSSTSSGSTSSGSSSSSQHNHVTRCFGAQQPQQ 69
            |..:|    .|:..||.:.:::.|.:             :|.:|.|                 |.
Human   101 PLQIF----PRACKPPGERNIHGLKV-------------NTRAGPS-----------------QH 131

  Fly    70 TPPVASSQVPPVPAASSSSAADRHRERIRQQACGKLQFGEGGANTHTFTSDDLEDEGEIGRGAFG 134
            :.|..|..:|      |:|......|..:..|.|::            ...|:.....:|.|..|
Human   132 SSPAVSDSLP------SNSLKKSSAELKKILANGQM------------NEQDIRYRDTLGHGNGG 178

  Fly   135 AVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFKEGDCWICME 199
            .|.|.......|::|||.|...:..:.|||::.:||::.|.:.. ||:.||||.|.|....||.|
Human   179 TVYKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSS-YIIGFYGAFFVENRISICTE 242

  Fly   200 LMD-TSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSNILLHRRGDI 263
            .|| .|||     :|.|    :||.:|.:|.||.|..|.|| ..|||:||||||||:|::.||.:
Human   243 FMDGGSLD-----VYRK----MPEHVLGRIAVAVVKGLTYL-WSLKILHRDVKPSNMLVNTRGQV 297

  Fly   264 KLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERAKGYDVRSDVWSLGITLMEVATGNFPY-- 326
            ||||||:|.|||:|||||. .|...|||||||..|:   |.:.||||||||:.||:|.|.|||  
Human   298 KLCDFGVSTQLVNSIAKTY-VGTNAYMAPERISGEQ---YGIHSDVWSLGISFMELALGRFPYPQ 358

  Fly   327 --RKWDSVFE-QLCQ-VVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFI 387
              :...|:.. ||.| :|..:.|.|...    |||:.||.|:..|:.|:..:||....|:..|||
Human   359 IQKNQGSLMPLQLLQCIVDEDSPVLPVG----EFSEPFVHFITQCMRKQPKERPAPEELMGHPFI 419

  Fly   388 -RRGETSHTDVAVYVADILE 406
             :..:.:...|:::|...||
Human   420 VQFNDGNAAVVSMWVCRALE 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 122/297 (41%)
S_TKc 123..387 CDD:214567 117/270 (43%)
MAP2K5NP_660143.1 PB1_Map2k5 17..107 CDD:99717 2/9 (22%)
Interaction with MAPK7. /evidence=ECO:0000250 18..25
Interaction with MAP3K2/MAP3K3. /evidence=ECO:0000250 64..68
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..144 9/63 (14%)
Interaction with MAPK7. /evidence=ECO:0000250 117..131 4/43 (9%)
PKc_MKK5 164..442 CDD:132950 124/295 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.