DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and MAP2K2

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_016882478.1 Gene:MAP2K2 / 5605 HGNCID:6842 Length:512 Species:Homo sapiens


Alignment Length:353 Identity:118/353 - (33%)
Similarity:177/353 - (50%) Gaps:79/353 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PPVASSQVPPVPAASSSSAAD------------RHRERIRQQACGKLQFGEGGANTHTFTSDDLE 123
            |.:|....|....||.::..|            :.::|:......|.:.||       ...||.|
Human    16 PTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGE-------LKDDDFE 73

  Fly   124 DEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGAL 188
            ...|:|.|..|.|.|:..:....:||.|.|...:....:.|::.:|:|:.:.|. .|||.||||.
Human    74 RISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNS-PYIVGFYGAF 137

  Fly   189 FKEGDCWICMELMD-TSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKP 252
            :.:|:..||||.|| .|||:..     |:.:.|||.||.|:::|.:..|.||:|:.:|:||||||
Human   138 YSDGEISICMEHMDGGSLDQVL-----KEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKP 197

  Fly   253 SNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERAKGYDVRSDVWSLGITLM 317
            ||||::.||:|||||||:||||:||:|.: ..|.|.||||||:   :...|.|:||:||:|::|:
Human   198 SNILVNSRGEIKLCDFGVSGQLIDSMANS-FVGTRSYMAPERL---QGTHYSVQSDIWSMGLSLV 258

  Fly   318 EVATGNFPYRKWD---------------------------------------------SVFEQLC 337
            |:|.|.:|....|                                             ::||.|.
Human   259 ELAVGRYPIPPPDAKELEAIFGRPVVDGEEGEPHSISPRPRPPGRPVSGHGMDSRPAMAIFELLD 323

  Fly   338 QVVQGEPPRLLTSYNGMEFSKEFVDFVN 365
            .:|...||:|   .||: |:.:|.:|||
Human   324 YIVNEPPPKL---PNGV-FTPDFQEFVN 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 108/297 (36%)
S_TKc 123..387 CDD:214567 106/289 (37%)
MAP2K2XP_016882478.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2221
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.