DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and map2k1

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001008058.1 Gene:map2k1 / 493420 XenbaseID:XB-GENE-478822 Length:395 Species:Xenopus tropicalis


Alignment Length:393 Identity:130/393 - (33%)
Similarity:195/393 - (49%) Gaps:76/393 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QQTPPVASSQVPPVPAASSSSAA-----------DRHRERIRQQACGKLQFGEGGANTHTFTSDD 121
            |..|....:.|...|.|.::..|           ::.|:|:......|.:.||       ...||
 Frog    10 QLNPNPEGTAVNGTPTAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGE-------LKDDD 67

  Fly   122 LEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYG 186
            .|...|:|.|..|.|.|::.|....:||.|.|...:....:.|::.:|:|:.:.|. .|||.|||
 Frog    68 FEKVSELGAGNGGVVFKVSHKPTSLIMARKLIHLEIKPAIRNQIIRELQVLHECNS-PYIVGFYG 131

  Fly   187 ALFKEGDCWICMELMD-TSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDV 250
            |.:.:|:..||||.|| .|||:..     |:...|||.||.|:::|.:..|.||:|:.||:||||
 Frog   132 AFYSDGEISICMEHMDGGSLDQVL-----KKAGKIPEKILGKVSIAVIKGLTYLREKHKIMHRDV 191

  Fly   251 KPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERAKGYDVRSDVWSLGIT 315
            ||||||::.||:|||||||:||||:||:|.: ..|.|.||:|||:   :...|.|:||:||:|::
 Frog   192 KPSNILVNSRGEIKLCDFGVSGQLIDSMANS-FVGTRSYMSPERL---QGTHYSVQSDIWSMGLS 252

  Fly   316 LMEVATGNFPYRKWD-------------------------------------------SVFEQLC 337
            |:|:|.|.:|....|                                           ::||.|.
 Frog   253 LVEMAIGRYPIPPPDAKELELIFGCSVEGDPASSELAPRPRPPGRPISSYGPDSRPPMAIFELLD 317

  Fly   338 QVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFIRRGETSHTDVAVYVA 402
            .:|...||:|.:..    |..||.||||.||:|..::|....:|:...||::.|....|.|.::.
 Frog   318 YIVNEPPPKLPSGV----FGAEFQDFVNKCLVKNPAERADLKQLMVHSFIKQSELEEVDFAGWLC 378

  Fly   403 DIL 405
            ..:
 Frog   379 STM 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 119/333 (36%)
S_TKc 123..387 CDD:214567 112/307 (36%)
map2k1NP_001008058.1 PKc_MEK1 62..382 CDD:270816 120/341 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2221
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.