DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and msn

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster


Alignment Length:305 Identity:95/305 - (31%)
Similarity:143/305 - (46%) Gaps:46/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALF--- 189
            :|.|.:|.|.|....|..::.|:|.:..|.||:|  ::.:::.|:.|.:....|..:|||..   
  Fly    38 VGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEE--EIKLEINVLKKYSNHRNIATYYGAFIKKS 100

  Fly   190 ---KEGDCWICMELMD----TSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIH 247
               |:...|:.||...    |.|.|..|      .:.:.|..:|.|....:..|:||... |:||
  Fly   101 PPGKDDQLWLVMEYCGAGSVTDLVKSTK------GQSLKEEWIAYICREILRGLSYLHSN-KVIH 158

  Fly   248 RDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPY-MAPERI--DPERAKGYDVRSDV 309
            ||:|..|:||....::||.|||:|.||..:|.:.......|| ||||.|  |......||.|||:
  Fly   159 RDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDNRSDL 223

  Fly   310 WSLGITLMEVATGNFPYRKWDSVFEQLCQ---------VVQGEPPRLLTSYNGMEFSKEFVDFVN 365
            ||||||.:|:|....|          ||.         :.:..||||    ...::||:|..|::
  Fly   224 WSLGITALEMAESQPP----------LCDLHPMRALFLIPRNSPPRL----KSKKWSKKFHGFID 274

  Fly   366 TCLIKKESDRPKYSRLLEMPFIRRGETSHTDVAVYVADILESMEK 410
            |.|:|....||....||:..||:...|.. .|.:.:.|.::..:|
  Fly   275 TVLVKDYHQRPYTENLLKHGFIKDQPTDR-QVRIQLKDHIDRCKK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 94/298 (32%)
S_TKc 123..387 CDD:214567 89/280 (32%)
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 89/280 (32%)
S_TKc 32..296 CDD:214567 89/280 (32%)
CNH 1183..1484 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.