DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and Map2k5

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_038936881.1 Gene:Map2k5 / 29568 RGDID:61890 Length:487 Species:Rattus norvegicus


Alignment Length:401 Identity:142/401 - (35%)
Similarity:190/401 - (47%) Gaps:87/401 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKNLFATGSSRSRNPPDQLSLNNLSIRHPPSSTSSTSSGSTSSGSSSSSQHNHVTRCFGAQQPQQ 69
            |..:|    .|:..||.:.:::.|.:             :|.:|.|                 |.
  Rat   101 PLQIF----PRACKPPGERNIHGLKV-------------NTRAGPS-----------------QH 131

  Fly    70 TPPVASSQVPPVPAASSSSAADRHRERIRQQACGKLQFGEGGANTHTFTSDDLEDEGEIGRGAFG 134
            |.||.|..:|      |:|......|..:..|.|::            ...|:.....:|.|..|
  Rat   132 TSPVVSDSLP------SNSLKKSSAELRKILANGQM------------NEQDIRYRDTLGHGNGG 178

  Fly   135 AVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFKEGDCWICME 199
            .|.|.......|::|||.|...:..:.|||::.:||::.|.:.. ||:.||||.|.|....||.|
  Rat   179 TVYKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSS-YIIGFYGAFFVENRISICTE 242

  Fly   200 LMD-TSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSNILLHRRGDI 263
            .|| .|||     :|.|    |||.:|.:|.||.|..|.|| ..|||:||||||||:|::..|.:
  Rat   243 FMDGGSLD-----VYRK----IPEHVLGRIAVAVVKGLTYL-WSLKILHRDVKPSNMLVNTSGQV 297

  Fly   264 KLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERAKGYDVRSDVWSLGITLMEVATGNFPY-- 326
            ||||||:|.|||:|||||. .|...|||||||..|:   |.:.||||||||:.||:|.|.|||  
  Rat   298 KLCDFGVSTQLVNSIAKTY-VGTNAYMAPERISGEQ---YGIHSDVWSLGISFMELALGRFPYPQ 358

  Fly   327 --RKWDSVFE-QLCQ-VVQGEPPRLLTSYNGMEFSKEFVDFV------NTCLIKKES--DRPKYS 379
              :...|:.. ||.| :|..:.|.|...    |||:.||.|:      ..|.....|  .|| |.
  Rat   359 IQKNQGSLMPLQLLQCIVDEDSPVLPLG----EFSEPFVHFITQWNRAGLCRTAHWSLETRP-YR 418

  Fly   380 RLLEMPFIRRG 390
            ..|:.||..||
  Rat   419 FTLKKPFSTRG 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 122/291 (42%)
S_TKc 123..387 CDD:214567 118/278 (42%)
Map2k5XP_038936881.1 PB1_Map2k5 17..107 CDD:99717 2/9 (22%)
PKc_like 164..401 CDD:419665 112/255 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.