DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and STK39

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_037365.2 Gene:STK39 / 27347 HGNCID:17717 Length:545 Species:Homo sapiens


Alignment Length:353 Identity:105/353 - (29%)
Similarity:166/353 - (47%) Gaps:49/353 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QQPQQTPPV--------ASSQVPPVPAASSSSAADRHRERIRQQACGKLQFGEGGANTHTFTSDD 121
            |.|||..||        |::...|.|||   .||.........||.|           .....|.
Human    12 QLPQQAAPVTAAAAAAPAAATAAPAPAA---PAAPAPAPAPAAQAVG-----------WPICRDA 62

  Fly   122 LEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIY--IVQF 184
            .|.:..||.||...|.....|...:.:|:|||.....:....:||.:::.:   ::|.:  :|.:
Human    63 YELQEVIGSGATAVVQAALCKPRQERVAIKRINLEKCQTSMDELLKEIQAM---SQCSHPNVVTY 124

  Fly   185 YGALFKEGDCWICMELMD--TSLDKFYKYIYEKQQRH---IPESILAKITVATVNALNYLKEELK 244
            |.:...:.:.|:.|:|:.  :.|| ..|||..:.:..   :.|:|:|.|....:..|:||....:
Human   125 YTSFVVKDELWLVMKLLSGGSMLD-IIKYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNGQ 188

  Fly   245 IIHRDVKPSNILLHRRGDIKLCDFGISGQLV-------DSIAKTKDAGCRPYMAPERIDPERAKG 302
             ||||:|..||||...|.:::.|||:|..|.       :.:.|| ..|...:||||.:  |:.:|
Human   189 -IHRDLKAGNILLGEDGSVQIADFGVSAFLATGGDVTRNKVRKT-FVGTPCWMAPEVM--EQVRG 249

  Fly   303 YDVRSDVWSLGITLMEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGME----FSKEFVDF 363
            ||.::|:||.|||.:|:|||..||.|:..: :.|...:|.:||.|.|.....|    :.|.|...
Human   250 YDFKADMWSFGITAIELATGAAPYHKYPPM-KVLMLTLQNDPPTLETGVEDKEMMKKYGKSFRKL 313

  Fly   364 VNTCLIKKESDRPKYSRLLEMPFIRRGE 391
            ::.||.|..|.||..:.||:..|.::.:
Human   314 LSLCLQKDPSKRPTAAELLKCKFFQKAK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 89/295 (30%)
S_TKc 123..387 CDD:214567 87/281 (31%)
STK39NP_037365.2 STKc_OSR1_SPAK 61..337 CDD:270787 88/284 (31%)
S_TKc 63..337 CDD:214567 87/282 (31%)
Interaction with RELT. /evidence=ECO:0000250|UniProtKB:Q9Z1W9 310..536 10/32 (31%)
Nuclear localization signal. /evidence=ECO:0000255 360..366
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..423
Caspase cleavage related site 387..391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.