DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and Map2k3

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_032954.1 Gene:Map2k3 / 26397 MGIID:1346868 Length:347 Species:Mus musculus


Alignment Length:376 Identity:176/376 - (46%)
Similarity:237/376 - (63%) Gaps:43/376 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PPSSTSSTSSGSTSSGSSSSSQHNHVTRCFGAQQPQQTPPVASSQVPP--VPAASSSSAADRHRE 95
            ||:|...|      .|.|...:...:: |.      ..||| |:..||  :.:.:..:..||:.|
Mouse     8 PPASLPQT------KGKSKRKKDLRIS-CV------SKPPV-SNPTPPRNLDSRTFITIGDRNFE 58

  Fly    96 RIRQQACGKLQFGEGGANTHTFTSDDLEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEK 160
                                 ..:|||....|:||||:|.|.|:...:...:|||||||:||:.:
Mouse    59 ---------------------VEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQ 102

  Fly   161 EQKQLLMDLEVVMKSNECIYIVQFYGALFKEGDCWICMELMDTSLDKFYKYIYEKQQRHIPESIL 225
            |||:|||||::.|::.:|.|.|.||||||:|||.|||||||||||||||:.:.||..: |||.||
Mouse   103 EQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLEKNMK-IPEDIL 166

  Fly   226 AKITVATVNALNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYM 290
            .:|.|:.|.||.:|..:|.:|||||||||:|:::.|.:|:|||||||.||||:|||.||||:|||
Mouse   167 GEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYM 231

  Fly   291 APERIDPE-RAKGYDVRSDVWSLGITLMEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGM 354
            |||||:|| ..|||:|:|||||||||::|:|...|||..|.:.|:||.|||:...|:|...    
Mouse   232 APERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPAD---- 292

  Fly   355 EFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFIRRGETSHTDVAVYVADIL 405
            :||.|||||.:.||.|..::|..|..|:|.||....:|..||:|.:|.:||
Mouse   293 QFSPEFVDFTSQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEIL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 158/290 (54%)
S_TKc 123..387 CDD:214567 149/264 (56%)
Map2k3NP_032954.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 13/50 (26%)
PKc_MKK3_6 62..344 CDD:173729 160/287 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51923
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 1 1.000 - - FOG0001217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101822
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.