DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and byr1

DIOPT Version :9

Sequence 1:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_593026.1 Gene:byr1 / 2542137 PomBaseID:SPAC1D4.13 Length:340 Species:Schizosaccharomyces pombe


Alignment Length:355 Identity:124/355 - (34%)
Similarity:183/355 - (51%) Gaps:58/355 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PAASSSSAADRHRERI-------------RQQACGKLQFGEGGANTHTFTSDDLEDEG-----EI 128
            |.||..|:.:.|:|.:             ..:.|..:       |.......||::..     .:
pombe    15 PNASVKSSDNDHKEELINNQKSFESNVEAFMEQCAHM-------NRRPAWISDLDNSSLEVVRHL 72

  Fly   129 GRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNEC--IYIVQFYGALFKE 191
            |.|..|||:.:..:.:  .||.|.:....|.|.|||:|.:|.|:   :.|  .|||.||||...:
pombe    73 GEGNGGAVSLVKHRNI--FMARKTVYVGSDSKLQKQILRELGVL---HHCRSPYIVGFYGAFQYK 132

  Fly   192 GDCWICMELMDT-SLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSNI 255
            .:..:|||.||. |||...     ::...||..||.||..:.|..|.||...|.|||||:||||:
pombe   133 NNISLCMEYMDCGSLDAIL-----REGGPIPLDILGKIINSMVKGLIYLYNVLHIIHRDLKPSNV 192

  Fly   256 LLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERAKGYDVRSDVWSLGITLMEVA 320
            :::.||:|||||||:||:||:|:|:| ..|...||:||||   |...|.|:||:|||||:::|:|
pombe   193 VVNSRGEIKLCDFGVSGELVNSVAQT-FVGTSTYMSPERI---RGGKYTVKSDIWSLGISIIELA 253

  Fly   321 TGNFPYRKW------DS--VFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPK 377
            |...|   |      ||  :.:.|..:||.|||||.:|     |.::...||:.||.|..:.|..
pombe   254 TQELP---WSFSNIDDSIGILDLLHCIVQEEPPRLPSS-----FPEDLRLFVDACLHKDPTLRAS 310

  Fly   378 YSRLLEMPFIRRGETSHTDVAVYVADILES 407
            ..:|..||:.::....:.|:|.:.::...|
pombe   311 PQQLCAMPYFQQALMINVDLASWASNFRSS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 115/305 (38%)
S_TKc 123..387 CDD:214567 111/279 (40%)
byr1NP_593026.1 PKc_Byr1_like 60..334 CDD:270792 115/295 (39%)
Pkinase 66..320 CDD:278497 111/275 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48013
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2221
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.