DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP4F2

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:535 Identity:143/535 - (26%)
Similarity:249/535 - (46%) Gaps:74/535 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLASIILSGWLL---LAWLYFLWS------------RRRYYKVAWQLRGPIGWPLIGMGLQMMNP 50
            :|..::.:.|||   |||.|..:.            ||.::   |..:|            |:||
Human    20 LLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWF---WGHQG------------MVNP 69

  Fly    51 -ETFLQYMDGLSRQFKAPFISWMG-TSCFLYINDPHSVEQILNSTHCTNKGD--FYRFMSSAIGD 111
             |..::.:..|...:...|..||| .|..|.:..|..:..::|::......|  ||.|:...:||
Human    70 TEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLGD 134

  Fly   112 GLFTSSSPRWHKHRRLINPAFGRQILSNFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQILKKIV 176
            ||..|:..:|.:|||::.|||...||..::.|||....::..|.:|...:....|::::.:..:.
Human   135 GLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMT 199

  Fly   177 LEAACQTTMGKKMNFQHDGSLCIFK------AYNGLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQ 235
            |::.      :|..|..| |.|..|      |...|:.:..||.....|:.|.:|..:...:..:
Human   200 LDSL------QKCVFSFD-SHCQEKPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFR 257

  Fly   236 KVVGILFGFIEQLLEPIVSVVAANSNPDQQRSE-MEMRGKSKAI-FIE--QVREHVERGQLSWQD 296
            :...::..|.:.:::.     ...:.|.|...: ::.:.|||.: ||:  .:.:..:..:||.:|
Human   258 RACRLVHDFTDAVIQE-----RRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDED 317

  Fly   297 VRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLH---KELVTELPPSGDINLEQLQRLEYT 358
            :|.||:..:....:||::.|.:.:..||.||.|||:..   :||:.:..|. :|..:.|..|.:.
Human   318 IRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPK-EIEWDDLAHLPFL 381

  Fly   359 EMVINEAMRLFAPVPMVLRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRTYNP 423
            .|.:.|::||..|||::.|...|||.|.  ||. :||:|....|.::....:..|| |....|:|
Human   382 TMCMKESLRLHPPVPVISRHVTQDIVLP--DGR-VIPKGIICLISVFGTHHNPAVW-PDPEVYDP 442

  Fly   424 DAHFGLDS---PQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRI---STEARLE-EL 481
               |..|.   .:|...||:||:.|.|.|||..:|...||::||.....:|:   .||.|.: ||
Human   443 ---FRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEPRRKPEL 504

  Fly   482 LVKGNISLKLKDYPL 496
            :::....|.|:..||
Human   505 VLRAEGGLWLRVEPL 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 123/463 (27%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 8/36 (22%)
p450 52..515 CDD:365848 132/497 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.