DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and DIT2

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_010690.1 Gene:DIT2 / 852011 SGDID:S000002810 Length:489 Species:Saccharomyces cerevisiae


Alignment Length:416 Identity:87/416 - (20%)
Similarity:168/416 - (40%) Gaps:66/416 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YRFMSSAIGDGLFTSSSPRWHKHRRLINPAFGRQILSNF--LPIFNAEAEVLLQKLELEGVQHGK 164
            |..:::..||.:.::....|..:|..:...     |.:|  .|||. .|::|...::...::...
Yeast   108 YSALAAYTGDNVISAYGAVWRNYRNAVTNG-----LQHFDDAPIFK-NAKILCTLIKNRLLEGQT 166

  Fly   165 RLEIYQILKKIVLEAACQTTMGKKMNFQHDGSLCIFKAYNGLTEVCV---KRMLSPWL--YPDL- 223
            .:.:..:.:::.|:...|..:|  .:|   |:|...|  |...|..:   |::..|:.  :|.| 
Yeast   167 SIPMGPLSQRMALDNISQVALG--FDF---GALTHEK--NAFHEHLIRIKKQIFHPFFLTFPFLD 224

  Fly   224 ---IYRRSGLFRLQQKVVGILFGFIEQLLEPIVSVVAANSNPDQQRSEMEMRGKSKAIFIEQVRE 285
               |..|...|:   .||    .|.|.|::.:...:..|...:|......          :.:|.
Yeast   225 VLPIPSRKKAFK---DVV----SFRELLVKRVQDELVNNYKFEQTTFAAS----------DLIRA 272

  Fly   286 HVERGQLSWQDVRDEANVTIAATFETTSTALYFTILCLAMHPC-YQEKLHKELVTELPPSGDINL 349
            | ....:.::.:.|...:.:.|..|........::..||.:.. :||||.||:.....|.|..:|
Yeast   273 H-NNEIIDYKQLTDNIVIILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDPKGLADL 336

  Fly   350 EQLQRLEYTEMVINEAMRLFAPVPMVL-RSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERV 413
            ..|....:      |.:|::.|:..:: |...:..:|   ..|.:||:|..:|.:.:....|.:.
Yeast   337 PLLNAFLF------EVVRMYPPLSTIINRCTTKTCKL---GAEIVIPKGVYVGYNNFGTSHDPKT 392

  Fly   414 WGPLSRTYNPDAHFGLD--------SPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSY 470
            ||..:..:.|: .:|.|        ...::..|...|..|.|.|:|.:.|...|::.||.:.:.:
Yeast   393 WGTTADDFKPE-RWGSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQF 456

  Fly   471 RISTEARLEELLVKGN----ISLKLK 492
            |.|.:...||.|....    ::||||
Yeast   457 RWSLDPEWEEKLTPAGPLCPLNLKLK 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 79/392 (20%)
DIT2NP_010690.1 CYP56-like 65..485 CDD:410693 87/416 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I1949
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1605
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.