DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP721A1

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_177649.1 Gene:CYP721A1 / 843850 AraportID:AT1G75130 Length:505 Species:Arabidopsis thaliana


Alignment Length:463 Identity:109/463 - (23%)
Similarity:192/463 - (41%) Gaps:93/463 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NPETFLQ----YMDGLSRQFKAPFISWMGTSCFLYINDPHSVEQILNSTHCTNKGDFYRFMSSAI 109
            ||..|:.    :....||.:...|:.|.|:...:..:||..:.:.|     |..|.|.|...:.:
plant    70 NPHEFVHRVAPHYHEWSRVYGKTFLYWFGSKPVVATSDPRLIREAL-----TTGGSFDRIGHNPL 129

  Fly   110 GDGLFTSSSP-----RWHKHRRLINPAFGRQILSNFLPIFNAEAEVLLQKLELEGVQHGK---RL 166
            ...|:....|     :|..|||:...||..:.|..::|.......:|::|  .|.:::|.   .|
plant   130 SKLLYAQGLPGLRGDQWAFHRRIAKQAFTMEKLKRWVPQMVTSTMMLMEK--WEDMRNGGEEIEL 192

  Fly   167 EIYQILKKIVLEAACQTTMGKKMNFQHDGSLCIFKAYNGLTEVCVKRMLSPWLYPDLIYRRSGLF 231
            |:::.:..:..|...:|..|   |...:|                                .|:|
plant   193 EVHKEMHNLSAEMLSRTAFG---NSVEEG--------------------------------KGIF 222

  Fly   232 RLQQKVVGILF---------GF-------------IEQLLEPIVSVVAANSNPDQQRSEMEMRGK 274
            .||::::.:.:         ||             ||:.:.  ||::....|   .::.:|..|.
plant   223 ELQERMMRLFYLVRWSVYIPGFRFFPSKTNREIWRIEKQIR--VSILKLIEN---NKTAVEKSGT 282

  Fly   275 SKAIFIE-QVREHVERGQLSWQDVRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLHKELV 338
            ....|:. ...::.:..:|..::|.||......|..|||:..:.|.::.|||:..:|....:|::
plant   283 LLQAFMSPYTNQNGQEEKLGIEEVTDECKTFYFAAKETTANLMTFVLVLLAMNQEWQNIAREEVI 347

  Fly   339 TELPPSGDINLEQLQRLEYTEMVINEAMRLFAPVPMVLRSADQDIQLKRGD-GEFLIPRGTQIGI 402
            ..|..:|...|:.||.|:...|:|||.:||:.|...:.|..     |||.. |:..||.|||:.:
plant   348 CVLGQTGLPTLDILQDLKTLSMIINETLRLYPPAMTLNRDT-----LKRAKLGDLDIPAGTQLYL 407

  Fly   403 DIYNMQRDERVWGPLSRTYNPDAHFGLDSPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIF 467
            .:..|..|:..||..:..:||..   .:.|::.:...|||..|.|.|:|...|....|.:||.|.
plant   408 SVVAMHHDKETWGDDAEEFNPRR---FEDPKKQSALLVPFGLGPRTCVGQNLAVNEAKTVLATIL 469

  Fly   468 R--SYRIS 473
            :  |:|:|
plant   470 KYYSFRLS 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 109/463 (24%)
CYP721A1NP_177649.1 p450 26..495 CDD:386267 109/463 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.