DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP96A15

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_176086.1 Gene:CYP96A15 / 842150 AraportID:AT1G57750 Length:497 Species:Arabidopsis thaliana


Alignment Length:520 Identity:110/520 - (21%)
Similarity:206/520 - (39%) Gaps:124/520 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LAWLYFLWSRRRYYKVAWQLRG-PI--GWPLIGM--GLQMMNPETF---LQYMD--GLSRQFKAP 67
            :.:::||.....|:.:..:.:| ||  .||.:.|  |:....|..:   ::.::  .|:..||.|
plant     8 VTFIFFLVCLFTYFFLQKKPQGQPILKNWPFLRMLPGMLHQIPRIYDWTVEVLEATNLTFYFKGP 72

  Fly    68 FISWMGTSCFLYINDPHSVEQILNSTHCT-NKGDFYRFMSSAIGDGLFTSSSPRWHKHRRLINPA 131
               |:..:..|:..||.::..||:|.... .||..::.:...:|:|:.|.....|.:.|:..:..
plant    73 ---WLSGTDMLFTADPRNIHHILSSNFGNYPKGPEFKKIFDVLGEGILTVDFELWEEMRKSNHAL 134

  Fly   132 FGRQILSNFLPIFNAEAEVLLQKLEL-EGV--------QHGKRLEIYQILKKIVLEAACQTTMGK 187
            |..|   :|:     |..|...|.:| ||:        |....:|:..:.::             
plant   135 FHNQ---DFI-----ELSVSSNKSKLKEGLVPFLDNAAQKNIIIELQDVFQR------------- 178

  Fly   188 KMNFQHDGSLCIFKAYNGLT------------------EVCVKRMLSPWLYPDLIYRRSGLFRLQ 234
               |..|.|..:...|:.::                  |....|...|.:          |:|||
plant   179 ---FMFDTSSILMTGYDPMSLSIEMLEVEFGEAADIGEEAIYYRHFKPVI----------LWRLQ 230

  Fly   235 QKV-VGI------LFGFIEQLLEPIVSVVAANSNPDQQRSEMEMRGKSKAIFIEQVREHVERGQL 292
            ..: :|:      ....:.::...|:|         .:|.|...|.|::....:.:..::.....
plant   231 NWIGIGLERKMRTALATVNRMFAKIIS---------SRRKEEISRAKTEPYSKDALTYYMNVDTS 286

  Fly   293 SW--------QDVRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLHKELVTELPPSGDINL 349
            .:        :.:||.....:.|..:|||:.|.:....|:.||....||..|:.|:      .:.
plant   287 KYKLLKPNKDKFIRDVIFSLVLAGRDTTSSVLTWFFWLLSKHPQVMAKLRHEINTK------FDN 345

  Fly   350 EQLQRLEYTEMVINEAMRLFAPVPMVLRS-ADQDIQLKRGDGEFLIPRG------TQIGIDIYNM 407
            |.|::|.|....::|:|||:.|:|...:| |..|:          :|.|      ::|.|.||.:
plant   346 EDLEKLVYLHAALSESMRLYPPLPFNHKSPAKPDV----------LPSGHKVDANSKIVICIYAL 400

  Fly   408 QRDERVWGPLSRTYNPDAHFGLDSPQRH--AFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSY 470
            .|...|||..:..:.|:.....:...||  ::.|:.|..|.|.|:|...|.:.||::...|.|:|
plant   401 GRMRSVWGEDALDFKPERWISDNGGLRHEPSYKFMAFNSGPRTCLGKNLALLQMKMVALEIIRNY 465

  Fly   471  470
            plant   466  465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 107/500 (21%)
CYP96A15NP_176086.1 PLN02169 1..497 CDD:177826 110/520 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1194
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.