DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP72C1

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:321 Identity:73/321 - (22%)
Similarity:120/321 - (37%) Gaps:79/321 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IILSGWLLLA--WLY----FLWSRRRYYKVAWQLRGPIGWPL-IGMGLQMMNPETFLQYMDGLSR 62
            :.|.|:|:|.  |::    ::|.|.:..:...:.:|..|... |.|| .|.......|....|..
plant    10 VFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMG-DMRESNQMDQVAHSLPL 73

  Fly    63 QFKAPFISWM-----------GTSCFLY--------INDPHSVEQILNSTHCTNKGDFYRFMSSA 108
            ...|.|:..|           |..||.:        :.||.::.:|::....        |....
plant    74 PLDADFLPRMMPFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIMSKHEL--------FPKPK 130

  Fly   109 IG-------DGLFTSSSPRWHKHRRLINPAFGRQILSNFLPIFNAEAEVLLQKLELEGVQHGKRL 166
            ||       .||.....|:|.|||.::||||....|.:.||.||:..:.:|::.|        ||
plant   131 IGSHNHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWE--------RL 187

  Fly   167 EIYQILKKIVLEAACQTTMG-KKMNFQHDGSLCIFKAYNGLTEVCVKRMLSPWLYPDLIYRRSGL 230
                        |:.:.||. ......||           ||    :.||:...:.|.......:
plant   188 ------------ASAKGTMELDSWTHCHD-----------LT----RNMLARASFGDSYKDGIKI 225

  Fly   231 FRLQQKVVGILFGFIEQLLEPIVSVVAANSNPDQQRSEMEMRGKSKAIFIEQVREHVERGQ 291
            |.:||:.:.:....|..:..|....:....|...:.:|.:||...||: ||...|.::||:
plant   226 FEIQQEQIDLGLLAIRAVYIPGSKFLPTKFNRRLRETERDMRAMFKAM-IETKEEEIKRGR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 66/287 (23%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.