DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP96A4

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_200045.1 Gene:CYP96A4 / 835308 AraportID:AT5G52320 Length:502 Species:Arabidopsis thaliana


Alignment Length:521 Identity:114/521 - (21%)
Similarity:211/521 - (40%) Gaps:119/521 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IGWPLIGM--GLQMMNPETFLQYMDGLSRQ-----FKAPFISWMGTSCFLYINDPHSVEQILNST 93
            :.||::||  |:....|..:....:.|..:     |..|::|  ||...|.: ||.:::.||:|.
plant    35 MNWPVLGMLPGVLFQIPRIYDFVTEALEAENMTGCFIGPWLS--GTDILLTV-DPVNIQYILSSN 96

  Fly    94 HCT-NKGDFYRFMSSAIGDGLFTSSSPRWHKHRRLINPAFGRQILSNF-------------LPIF 144
            ... .||..:..:...:|||:|...|..|...|...:..|..|...:|             :||.
plant    97 FVNYPKGKKFNKIFEFLGDGIFNVDSGLWEDMRNSSHAIFSHQDFQSFSVSTSVSKLSQGLVPIL 161

  Fly   145 -NAEAEVLLQKLELEGVQHGKRLEIYQILKKIVLEAACQTTMG----------KKMNFQHDGSLC 198
             ||..:.:|             :::..:.::.:.:.:.....|          .|:.|.      
plant   162 DNAVEKHIL-------------VDLQDLFQRFLFDTSSTLMAGYDPKSLSVEMPKVEFA------ 207

  Fly   199 IFKAYNGLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKV-VGIL------FGFIEQLLEPIVSVV 256
              .|.:|:.:....|.|.|          :.|:.:|..: |||.      ....:|:|..|:|. 
plant   208 --DAMDGVADAMFYRHLKP----------AFLWSIQSWIGVGIEKKMRRGLDVFDQMLGKIISA- 259

  Fly   257 AANSNPDQQRSEMEMRG----KSKA-------IFIEQVR-EHVERGQLSWQDVRDEANVTIAATF 309
                    :|.|::..|    |.:|       :.|:..: :|::.....:  :||.....:.|..
plant   260 --------KREEIKNHGIHDSKGEAMDVLTYYMTIDTTKYKHLKPSNDKF--IRDTILGLVIAAR 314

  Fly   310 ETTSTALYFTILCLAMHPCYQEKLHKELVTELPPSGDINLEQLQRLEYTEMVINEAMRLFAPVPM 374
            :|||:||.:....|:.:|....|:.:|:..::|.....:|:   :|.|.:..:.|.:||:..||.
plant   315 DTTSSALTWFFWLLSKNPEAMTKIRQEINKKMPKFDPADLD---KLVYLDGAVCETLRLYPSVPF 376

  Fly   375 VLRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRTYNPDAHFGLDS---PQRHA 436
            ..:|..:...|..|   ..:.:..::.|.||::.|.:.|||..:..:.|:.... ||   .|..:
plant   377 NHKSPAKPDVLPSG---HKVDKNWRVVIPIYSLGRMKSVWGDDAEDFRPERWIS-DSGMLRQESS 437

  Fly   437 FAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRISTEARLEELLVKGNISLKLKDYP--LCRV 499
            :.|:.|..|.|.|:|.|...:.||.:...|.|:|.|.        :|:|:   |.|..|  |.|:
plant   438 YKFLAFNAGPRTCLGKRLTFLQMKTVAVEIIRNYDIK--------VVEGH---KPKPVPSVLLRM 491

  Fly   500 E 500
            :
plant   492 Q 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 107/491 (22%)
CYP96A4NP_200045.1 p450 1..501 CDD:416425 114/521 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1194
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.