DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and AT5G51900

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_200003.1 Gene:AT5G51900 / 835265 AraportID:AT5G51900 Length:242 Species:Arabidopsis thaliana


Alignment Length:271 Identity:48/271 - (17%)
Similarity:85/271 - (31%) Gaps:121/271 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 FIEQVREHVERGQLSWQD--------------------------------VRDEANVTIAATFET 311
            :|...||.|:|.|::..|                                :||.....:.|..:|
plant    39 YISARREEVKRSQVNNNDHFIRDSHANLLTSHIKLDTTQYQLLDPINDKFLRDNVFALLLAGRDT 103

  Fly   312 TSTALYFTILCLAMHPCYQEKLHKELVTELP--------PSGDINLEQLQRLEYTEMVINEAMRL 368
            |::||.:....|:.:|....|:.:|:...||        ||.|                      
plant   104 TASALTWFFWFLSENPLVVTKIRQEIDMNLPRSCSGQERPSCD---------------------- 146

  Fly   369 FAPVPMVLRSADQD-------IQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRTYNPDAH 426
                ||...:.|.:       |:::..:.:|                ||.||             
plant   147 ----PMEYLNKDDESCMGRRCIRIQAREMDF----------------RDRRV------------- 178

  Fly   427 FGLDSPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSY--RISTEARLE---ELLVKGN 486
                |.|..:          |:|.|.:.|.:.||::...|.::|  :::...:.|   .|::|..
plant   179 ----SIQCRS----------RICHGKQRAMVQMKIVAVEILQNYDIKVANGQKFEPDTSLILKMK 229

  Fly   487 ISLKLKDYPLC 497
            ...|:|....|
plant   230 HGFKVKINKRC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 42/243 (17%)
AT5G51900NP_200003.1 p450 <2..239 CDD:299894 47/268 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.