DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP96A12

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_195661.1 Gene:CYP96A12 / 830105 AraportID:AT4G39510 Length:508 Species:Arabidopsis thaliana


Alignment Length:547 Identity:122/547 - (22%)
Similarity:214/547 - (39%) Gaps:112/547 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LASI-ILSGWLLLAWLYFLWSRRRYYKVAWQLRGPI--GWPLIGM--GLQM-------------- 47
            :||: :|...:.:..|:|.     ||....:..|.:  .||:|||  |..|              
plant     1 MASVSLLDVAIAIICLFFF-----YYMYFKKPHGQVFRNWPVIGMLPGFLMVLHRIYNFGVEALE 60

  Fly    48 MNPETFLQYMDGLSRQFKAPFISWMGTSCFLYINDPHSVEQILNSTHCT-NKGDFYRFMSSAIGD 111
            |:..|||         ||.|   |......|:..||.::..||:|.... .||..::.:....|:
plant    61 MSHLTFL---------FKGP---WFAEMDMLFTVDPANIHYILSSNFSNYTKGADFKEVFDVFGE 113

  Fly   112 GLFTSSSPRWHKHRR-----LINPAFGRQILS--------NFLPIFNAEAEVLLQKLELEGVQHG 163
            .:|:|.|..|...|:     |.:..|.:..||        ..:|:||       |..|.|     
plant   114 MIFSSDSELWKNQRKAAQFMLNHQGFQKLSLSATRSKLYDGLVPLFN-------QCCEEE----- 166

  Fly   164 KRLEIYQILKKIVLEAACQTTMG---KKMNFQHDGSLCIFKAYNGLTEVCVKRMLSPWLYPDLIY 225
            |.:::.|:.::...:.......|   |.::.:.. .:...||.:.|.|....|.:.|..:     
plant   167 KVVDLQQVFQRFTFDTTFFIVTGFDPKSLSIEMP-EVEYAKALDDLGEGIFYRHIKPKFF----- 225

  Fly   226 RRSGLFRLQQKVVGILFGFIEQ--LLEPIVS--------VVAANSNPDQQRSEMEMRGKSKAIFI 280
                 ::||.:     ||..::  :.|...:        ::|.......|..:....|:|:.:..
plant   226 -----WKLQNR-----FGLGQEKRMTEADATFDRVSAKYILAKREEIRSQGIDHHANGESEDLLT 280

  Fly   281 EQVREHVERGQL----SWQDVRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLHKELVTE- 340
            ..::....:.:|    ..:.:||.......|..:|||:||.:....|:.:|....|:.||::.: 
plant   281 SHIKLDTTKYELLNPSDDKFLRDTILAFNLAGRDTTSSALSWFFWLLSENPQVVTKIRKEIIDKN 345

  Fly   341 LPPSGDINLEQLQRLEYTEMVINEAMRLFAPVPMVLRSADQDIQLKRGDGEFLIPRGTQIGIDIY 405
            :...|....|.|.:|.|....:.|:|||:.||....:|..:...|..|   ..:...:.|.|.::
plant   346 ISKDGRNGQENLDKLVYLHAALYESMRLYPPVAFQRKSPIKPDVLPSG---HKVEANSVIIIFLF 407

  Fly   406 NMQRDERVWGPLSRTYNPDAHFGLDSPQRHA--FAFVPFTKGLRMCIGYRYAQMLMKLLLARIFR 468
            .:.|...|||..:..:.|:.........|||  |.|:.|..|.|.|.|.:.|..|||.::..|.:
plant   408 ALGRMRAVWGEDATEFKPERWVSESGGLRHAPSFKFLSFNAGPRTCPGKQLAMTLMKTVVVEILQ 472

  Fly   469 SYRISTEARLEELLVKGNISLKLKDYP 495
            :|.|.        ::||.   |::..|
plant   473 NYDID--------VIKGQ---KIEPEP 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 111/492 (23%)
CYP96A12NP_195661.1 CYP86A 66..498 CDD:410687 105/477 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1194
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.