DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP702A5

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001078393.1 Gene:CYP702A5 / 827206 AraportID:AT4G15393 Length:467 Species:Arabidopsis thaliana


Alignment Length:486 Identity:107/486 - (22%)
Similarity:184/486 - (37%) Gaps:120/486 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GPIGWPLIGMGLQMMNPETFLQYMD----------------------------GLSRQF-KAPFI 69
            |.:|:|:||...:.|.....:|...                            ||:.:. |...|
plant    38 GSMGYPIIGETFEFMKLHDAIQLPTFVKEKLLRHGPVFRTSLFGGKVIISTDIGLNMEIAKTNHI 102

  Fly    70 SWMGTSCFLYINDPHSVEQILNSTHCTNKGDFYRFMSSAIGDGLFTSSSPRWHKH-RRLINPAFG 133
            ..|          |.|:|::..:|:                  ||.:...  ||| |.|.|...|
plant   103 PGM----------PKSLERLFGATN------------------LFVNKDT--HKHARSLTNQFLG 137

  Fly   134 RQILSNFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQILKKIVLEAACQTTMGKKMNFQHDGSLC 198
            .|.|.  |.:.. :.:.|.:....||.:.| .|::.:...|||:|...:..||:           
plant   138 SQALK--LRMIQ-DIDFLARTHMKEGARKG-CLDVKETASKIVIECLSKKVMGE----------- 187

  Fly   199 IFKAYNGLTEVCVKRMLSPW-LYPDLIYR------RSGLFRLQQKVVGILFGFIEQLLEPIVSVV 256
                   :.....|.:...| .:|...:|      .:|::|    :|......::.:.|.:|...
plant   188 -------MEPEAAKELTLCWTFFPRDWFRFAWNFPGTGVYR----IVKARNRMMKVIKETVVKKR 241

  Fly   257 AANSNPDQQRSEMEMRGKSKAIFIEQVREHVERGQLSWQDVRDEANVTIAATFETTSTALYFTIL 321
            |:              ||....|.|.:....|...:|.:...:..........|||...|..||.
plant   242 AS--------------GKKLGEFFETIFGDTESVTMSIEIATEYIFTLFVLANETTPGVLAATIK 292

  Fly   322 CLAMHPCYQEKL---HKELVTE---LPPSGDINLEQLQRLEYTEMVINEAMRLFAPVPMVLRSAD 380
            .::.:|...::|   |:.:|.:   ...:.|:..|..:.:.:|:|||||::|:.:.||.|||..|
plant   293 LISDNPKVMQELRREHEGIVQDKIKKDETADLTWEDYKSMTFTQMVINESLRITSTVPTVLRIID 357

  Fly   381 QDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRTYNPDAHFGLDSPQRHAFAFVPFTKG 445
            .:||.    |::.||.|.......|.....|:...||:  :||....|.|.....:..::||..|
plant   358 HEIQF----GDYTIPAGWIFMGYPYVHFNPEKYDDPLA--FNPWRWKGKDLSTIVSKTYLPFGSG 416

  Fly   446 LRMCIGYRYAQMLMKLLLARIFRSYRISTEA 476
            .|:|:|..:.::.|.:.:..:|| ||.|.:|
plant   417 TRLCVGAEFVKLQMAIFIHHLFR-YRWSMKA 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 105/482 (22%)
CYP702A5NP_001078393.1 p450 30..448 CDD:386267 107/486 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.