DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP72A9

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_188081.2 Gene:CYP72A9 / 820691 AraportID:AT3G14630 Length:563 Species:Arabidopsis thaliana


Alignment Length:540 Identity:113/540 - (20%)
Similarity:214/540 - (39%) Gaps:151/540 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WLLLAWLYFLWSRRRYYKVAWQLRGPIG---WPLIG---MGLQM--------MNP-----ETFLQ 55
            |.:|.|   :|.:.:..:...:.:|.:|   .||:|   ....|        |.|     ...:.
plant    73 WRILEW---VWLKPKMLESYLRRQGLVGTRYTPLVGDVRRSFSMLKEARSKPMKPTDDLISLVMP 134

  Fly    56 YMDGLSRQFKAPFISWMGTSCFLYINDPHSVEQILNSTHCTNKGDFYRF-------MSSAIGDGL 113
            |...:...:...|.:|.|....:.|.:|..::::.|.        ||.|       ::|.:.|||
plant   135 YSFHMLNTYGKTFFTWSGPIPAITIMNPQLIKEVYNK--------FYDFEKTHTFPLTSLLTDGL 191

  Fly   114 FTSSSPRWHKHRRLINPAFGRQILSNFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQILKKIVLE 178
            ..:...:|.|||::|||||..:.:.|.:|.|                            .|..:|
plant   192 ANADGDKWVKHRKIINPAFHFEKIKNMVPTF----------------------------YKSCIE 228

  Fly   179 AACQTTMGKKMNFQHDGSLCIFKAYNGLTEVCVKRMLSPWLY---PDLIYR-------RSG--LF 231
            ..|:   .:|: ....||.|....:             ||:.   .|:|.|       :.|  :|
plant   229 VMCE---WEKL-VSDKGSSCELDVW-------------PWIVNMTGDVISRTAFGSSYKEGQRIF 276

  Fly   232 RLQQKVVGILFGFIEQLLEPIVSVVAANSN--------PDQQRSEMEMRGKSKAIFIEQVREHVE 288
            .||.::..::             ::|...|        |.:....|:...|...:.:..:..|.|
plant   277 ILQAELAHLI-------------ILALGKNYIPAYRHFPTKNNRRMKTIVKEIQVILRGIISHRE 328

  Fly   289 RGQ--------------------------LSWQDVRDEANVTIAATFETTSTALYFTILCLAMHP 327
            :.:                          |:.:::.:|..:...|..||||..|.:|::.|:.|.
plant   329 KARDAGEAPSDDLLGILLKSNSEQSKGNGLNMEEIMEECKLFYFAGQETTSVLLAWTMVLLSQHQ 393

  Fly   328 CYQEKLHKELVTELPPSGDINLEQLQRLEYTEMVINEAMRLFAPVPMVLRSADQDIQLKRGDGEF 392
            .:|.:..:| |.::......:|:.:.:|:...|:|.|.:||:.||..:.|:..::|:|    |:.
plant   394 DWQARAREE-VMQVFGHNKPDLQGINQLKVMTMIIYEVLRLYPPVIQMNRATHKEIKL----GDM 453

  Fly   393 LIPRGTQIGIDIYNMQRDERVWGPLSRTYNPDAHF--GLDSPQRHAFAFVPFTKGLRMCIGYRYA 455
            .:|.|.|:.:.:..:.||.::||..:..:.|: .|  |:....::...|:||..|.|:|||..:|
plant   454 TLPGGIQVHMPVLLIHRDTKLWGDDAAEFKPE-RFKDGIAKATKNQVCFLPFGWGPRICIGQNFA 517

  Fly   456 QMLMKLLLARIFR--SYRIS 473
            .:..|:.||.|.:  |:.:|
plant   518 LLEAKMALALILQRFSFELS 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 109/517 (21%)
CYP72A9NP_188081.2 p450 59..563 CDD:386267 113/540 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.