DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP72A7

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_188079.1 Gene:CYP72A7 / 820689 AraportID:AT3G14610 Length:512 Species:Arabidopsis thaliana


Alignment Length:498 Identity:118/498 - (23%)
Similarity:222/498 - (44%) Gaps:56/498 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLASIILSGWLLLAWLYFLWSRRRYYKVAWQLRGPIG---WPLIG---MGLQMM----------- 48
            ::|.::|..|.::.|   :|.:.:..:.:.:.:|..|   .||:|   ..:.||           
plant    12 LVAVVVLWTWRIVKW---VWIKPKMLESSLKRQGLTGTPYTPLVGDIKRNVDMMMEARSKPINVT 73

  Fly    49 ---NPETFLQYMDGLSRQFKAPFISWMGTSCFLYINDPHSVEQILNSTHCTNKGDFYRFMSSAIG 110
               .|......:..|:...|..|| |:|....:.|.:|..::::.|..:...|...:..:....|
plant    74 DDITPRLLPLALKMLNSHGKTFFI-WIGPLPTIVITNPEQIKEVFNKVNDFEKASTFPLIRLLAG 137

  Fly   111 DGLFTSSSPRWHKHRRLINPAFGRQILSNFLPIF-NAEAEVLLQKLEL-EGVQHGKRLEIYQILK 173
             ||.:....:|..|||:|||||..:.:.|.:|.| :..:||:.|..:| ...:....::::..|.
plant   138 -GLASYKGDKWASHRRIINPAFHLEKIKNMIPAFYHCCSEVVCQWEKLFTDKESPLEVDVWPWLV 201

  Fly   174 KIVLEAACQTTMGKKMNFQHDGSLCIFKAYNGLTEVCVKRMLSPWL-----YPDLIYRRSGLFRL 233
            .:..:....|..|....   :|.. ||:....|.|:..:.....::     ||....||  :..:
plant   202 NMTADVISHTAFGSSYK---EGQR-IFQLQGELAELIAQAFKKSYIPGSRFYPTKSNRR--MKAI 260

  Fly   234 QQKVVGILFGFIEQLLEPIVSVVAANSNPDQQRSEMEMRGKSKAIFIEQVREHVERGQLSWQDVR 298
            .::|..||.|.:.:..:...:...||.         ::.|    |.:|...|..:...:|.:||.
plant   261 DREVDVILRGIVSKREKAREAGEPAND---------DLLG----ILLESNSEESQGNGMSVEDVM 312

  Fly   299 DEANVTIAATFETTSTALYFTILCLAMHPCYQEKLHKELVTELPPSGDINLEQLQRLEYTEMVIN 363
            .|..:...|..||||..|.:|::.|:.|..:|.:..:|::..|..:...::|.|..|:...|:.|
plant   313 KECKLFYFAGQETTSVLLVWTMVLLSHHQDWQARAREEVMQVLGENNKPDMESLNNLKVMTMIFN 377

  Fly   364 EAMRLFAPVPMVLRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRTYNPDA-HF 427
            |.:||:.||..:.|..:::::|    ||..:|.|.||.:....:|||..:||..:..:.|:. ..
plant   378 EVLRLYPPVAQLKRVVNKEMKL----GELTLPAGIQIYLPTILVQRDTELWGDDAADFKPERFRD 438

  Fly   428 GLDSPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSY 470
            ||....::..:|.||..|.|:|||..:|.:..|:.:|.|.:.:
plant   439 GLSKATKNQVSFFPFGWGPRICIGQNFAMLEAKMAMALILQKF 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 113/466 (24%)
CYP72A7NP_188079.1 p450 21..512 CDD:299894 116/489 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I1170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.