DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP704A1

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_850427.2 Gene:CYP704A1 / 819098 AraportID:AT2G44890 Length:511 Species:Arabidopsis thaliana


Alignment Length:460 Identity:110/460 - (23%)
Similarity:192/460 - (41%) Gaps:68/460 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LYINDPHSVEQILNST-HCTNKGDFYRF-MSSAIGDGLFTSSSPRWHKHRRLINPAFGRQILSNF 140
            ::..||.:||.||.:. |..:||..... ::..:|.|:|.....:|.:.|:|::..|..::|.||
plant    81 IFTADPRNVEHILKTRFHNYSKGPVGTVNLADLLGHGIFAVDGEKWKQQRKLVSFEFSTRVLRNF 145

  Fly   141 -LPIFNAEAEVLLQKLELEGVQHGKRLEIYQILKKIVLEAACQTTMGKKM----NFQHDGS--LC 198
             ..:|...|..|:..: .|....||..:...:|.|..|::..:...|.::    .|..:|.  :.
plant   146 SYSVFRTSASKLVGFI-AEFALSGKSFDFQDMLMKCTLDSIFKVGFGVELGCLDGFSKEGEEFMK 209

  Fly   199 IFKAYNGLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKVVGILFGFIEQLLEPIVSVVAANSNPD 263
            .|...||.|.   .|:..|:.............|| :|.:.|:..|:..|:..            
plant   210 AFDEGNGATS---SRVTDPFWKLKCFLNIGSESRL-KKSIAIIDKFVYSLITT------------ 258

  Fly   264 QQRSEMEMRGKSKAIFIEQ---VREHV--------ERGQLSWQD--VRD-EANVTIAATFETTST 314
                      |.|.:..||   |||.:        |:...:..|  :|| ..||.:|.. :||:.
plant   259 ----------KRKELSKEQNTSVREDILSKFLLESEKDPENMNDKYLRDIILNVMVAGK-DTTAA 312

  Fly   315 ALYFTILCLAMHPCYQEKLHKEL---VTELPPSGDIN-------LEQLQRLEYTEMVINEAMRLF 369
            :|.:.:..|..:|..|||:.:|:   .:....:.|:|       .|.|.:::|....::|.|||:
plant   313 SLSWFLYMLCKNPLVQEKIVQEIRDVTSSHEKTTDVNGFIESVTEEALAQMQYLHAALSETMRLY 377

  Fly   370 APVPMVLRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRTYNPDAHF--GLDSP 432
            .|||..:|.|:.|..|..|   ..:.:|..|....|.|.|...:||..:..:.|:...  |:..|
plant   378 PPVPEHMRCAENDDVLPDG---HRVSKGDNIYYISYAMGRMTYIWGQDAEEFKPERWLKDGVFQP 439

  Fly   433 QRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRISTEARLEELLVKGNISLKLK-DYPL 496
            :.. |.|:.|..|.|:|||..:|...||::...:...:|........::..|..::|.:. ...|
plant   440 ESQ-FKFISFHAGPRICIGKDFAYRQMKIVSMALLHFFRFKMADENSKVSYKKMLTLHVDGGLHL 503

  Fly   497 CRVER 501
            |.:.|
plant   504 CAIPR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 105/430 (24%)
CYP704A1NP_850427.2 CYP86A 69..501 CDD:410687 107/451 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1194
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.