DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP4F12

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:535 Identity:143/535 - (26%)
Similarity:243/535 - (45%) Gaps:74/535 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLASIILSGWLL---LAWLYFLWSRRRYY-------KVAWQLRGPIGWPLIGMGLQMMNP-ETFL 54
            :|..:::..|||   |||.|..::..|..       |..|      .|..:|    ::.| |..|
Human    20 LLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNW------FWGHLG----LITPTEEGL 74

  Fly    55 QYMDGLSRQFKAPFISWMGTSC-FLYINDPHSVEQILNSTHCTNKGD--FYRFMSSAIGDGLFTS 116
            :....:|..:...|..|:|... |:.:..|.::..|.|::......|  |.||:...:|:|:..|
Human    75 KNSTQMSATYSQGFTVWLGPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGEGILLS 139

  Fly   117 SSPRWHKHRRLINPAFGRQILSNFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQILKKIVLEAAC 181
            ...:|.:|||::.|||...||.:::.|||..|.::|.|.:....:...||::::.:..:.|::. 
Human   140 GGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQHLASEGSSRLDMFEHISLMTLDSL- 203

  Fly   182 QTTMGKKMNFQHDGSLC------IFKAYNGLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKVVGI 240
                 :|..|..| |.|      .......|:.:..||......:.|.:|..|...|...:...:
Human   204 -----QKCIFSFD-SHCQERPSEYIATILELSALVEKRSQHILQHMDFLYYLSHDGRRFHRACRL 262

  Fly   241 LFGFIEQLLEPIVSVVAANSNPDQQRSEMEMRG---------KSKAI-FIE-QVREHVERGQ-LS 293
            :..|.:.::.             ::|..:..:|         |||.: ||: .:....|.|: ||
Human   263 VHDFTDAVIR-------------ERRRTLPTQGIDDFFKDKAKSKTLDFIDVLLLSKDEDGKALS 314

  Fly   294 WQDVRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLH---KELVTELPPSGDINLEQLQRL 355
            .:|:|.||:..:....:||::.|.:.:..||.||.|||:..   :||:.:..|. :|..:.|.:|
Human   315 DEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPK-EIEWDDLAQL 378

  Fly   356 EYTEMVINEAMRLFAPVPMVLRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRT 420
            .:..|.:.|::||..|.|.:.|...|||.|.  ||. :||:|....|||..:..:..|| |....
Human   379 PFLTMCVKESLRLHPPAPFISRCCTQDIVLP--DGR-VIPKGITCLIDIIGVHHNPTVW-PDPEV 439

  Fly   421 YNPDAHFGLDSPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRI---STEARLE-EL 481
            |:|......:|..|...||:||:.|.|.|||..:|...||::||.:...:|.   .||.|.: ||
Human   440 YDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKLEL 504

  Fly   482 LVKGNISLKLKDYPL 496
            :::....|.|:..||
Human   505 IMRAEGGLWLRVEPL 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 123/468 (26%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 130/488 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.