DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and Cyp12a5

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster


Alignment Length:545 Identity:109/545 - (20%)
Similarity:199/545 - (36%) Gaps:175/545 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LQMMNPETFLQYMDGLSRQF-KAPFI-SWMGTSCFLYINDPHSVEQILNSTHCTNKG-------- 99
            |:||      :.:|.|.:.: ...|: ..||....:..::|...|.:..     |:|        
  Fly    72 LEMM------EMIDALRQDYGNIIFLPGMMGRDGLVMTHNPKDFEVVFR-----NEGVWPFRPGS 125

  Fly   100 DFYRFMSSAIG-------DGLFTSSSPRWHKHRRLINP--------------------------- 130
            |..|:..:...       .|:..|....|...|.::||                           
  Fly   126 DILRYHRTVYRKDFFDGVQGIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVELIK 190

  Fly   131 ----AFGRQILSNFLPIFN-----AEAEVLLQK---LELEGVQHGKRLEIYQILKKIVLEAA--- 180
                |..:::..|||...|     :.:.|.|.|   |..|..::.:..::::.|.:..|.:|   
  Fly   191 EIRDASTQEVPGNFLETINRWTLESVSVVALDKQLGLLRESGKNSEATKLFKYLDEFFLHSADLE 255

  Fly   181 --------CQTTMGKKMNFQHDGSLCIFKAYNGLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKV 237
                    .:|.:.|||          .:..:.:.||.:|            |....:.||:   
  Fly   256 MKPSLWRYFKTPLLKKM----------LRTMDSVQEVTLK------------YVDEAIERLE--- 295

  Fly   238 VGILFGFIEQLLEPIVSVVAANSNPDQQRSEMEMRGKSKAIFIEQVREHVERGQLSWQDVRDEAN 302
                    ::..|.:|       .|:.::|.:|     |.:.:::....|            .|.
  Fly   296 --------KEAKEGVV-------RPEHEQSVLE-----KLLKVDKKVATV------------MAM 328

  Fly   303 VTIAATFETTSTALYFTILCLAMHPCYQEKLHKELVTELP-PSGDINLEQLQRLEYTEMVINEAM 366
            ..:.|..:|||:.....:||||.:|..|.:|.:|::..|| ...:.....::.:.|....|.|:.
  Fly   329 DMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKDSEFTEASMKNVPYLRACIKESQ 393

  Fly   367 RLFAPVPMVLRSADQDIQLKRG-------DGEFLIPRGTQIG-IDIYNMQRDERVWGPLSRTYNP 423
            |::   |:|:.:|       ||       .| :.:|.||.:. |.|.::..:|  :.|....:.|
  Fly   394 RVY---PLVIGNA-------RGLTRDSVISG-YRVPAGTIVSMIPINSLYSEE--YFPKPTEFLP 445

  Fly   424 DAHF-----------GLDSPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRI----S 473
            :...           ..|...::.|.|:||..|.|||:|.|..:|.::|..||:.|::.:    |
  Fly   446 ERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNHS 510

  Fly   474 TEARLEELLVK-GNISLKLK--DYP 495
            |:......|:. .||.||.|  |.|
  Fly   511 TKNAFRSALINLPNIPLKFKFTDVP 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 99/519 (19%)
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 102/524 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442736
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.