DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and Cyp12e1

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster


Alignment Length:492 Identity:102/492 - (20%)
Similarity:194/492 - (39%) Gaps:91/492 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ETFLQYMDGLSRQ----FKAPFISWMGTSCFLYINDPHSVEQILNSTHCTNKGDF-YRFMSSAIG 110
            |.||.    ::||    |:.|.::  ||...|.:| |...|.|..     |:|.: ||.....:.
  Fly    66 EMFLD----MNRQYGSIFRMPSVA--GTDLVLTMN-PQDYEVIFR-----NEGQYPYRRSFEVMD 118

  Fly   111 --------------DGLFTSSSPRWHKHRRLINPAF-----GRQILSNFLPIFNAEAEVLLQKLE 156
                          |||.:.:.|.|.|.|..:||..     .:..::|.:.:    ::..|:::.
  Fly   119 YFKRVHRREVFDGYDGLTSGNGPAWGKMRTAVNPILLQPRNAKLYMTNLVQV----SDEFLERIR 179

  Fly   157 L--EGVQHGKRLEIYQILKKIVLEAACQTT-------MGKKMNFQHDGSLCIFKAYNGLTEVCVK 212
            :  :.|......:....::.:|:|:.|...       :|::.|.:....|.:  |...:.|:..:
  Fly   180 IIRDPVTQEMPDDFAVDIRHLVIESICSVALNTHLGLLGEQRNNKDIQKLVL--ALQDVVELGFQ 242

  Fly   213 RMLSP--WLY-PDLIYRRSGLFRLQQKVVGILFGFIEQLLEPIVSVVAANSNPDQQRSEMEMRGK 274
            ..:.|  |.| |...:::  |.|....:....:..|...|:.|        ..|.:...:...|.
  Fly   243 LDIMPAFWKYLPMPNFKK--LMRSLDTITDFCYFHIGNALKRI--------EEDAKAGTLNEIGL 297

  Fly   275 SKAIFIEQVREHVERGQLSWQDVRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLHKELVT 339
            ..::..:..|...:...:...|:       :.|..:.|...|...:..|:..|..|.:|.:|:..
  Fly   298 ETSLLEKLARFDRQTAVIIAMDL-------LFAGADPTLVTLGGILFSLSKSPDKQARLLEEIRG 355

  Fly   340 ELP-PSGDINLEQLQRLEYTEMVINEAMRLFAPVPMVLRSADQDIQLKRGDGEFLIPRGTQIGID 403
            .|| ....:.:|.::.|.|....|.|.:|::...|..||....|:.|    ..:.:..||.:||.
  Fly   356 ILPNKDSSLTIENMRNLPYLRACIKEGIRMYPIGPGTLRRMPHDVVL----SGYRVVAGTDVGIA 416

  Fly   404 I-YNMQRDERVWGPLSRTYNPDAHFGLDSPQRH-------AFAFVPFTKGLRMCIGYRYAQMLMK 460
            . |.|...|: :.|..|.:.|: .:..|....|       .|.::||..|.|.|.|.|...|:::
  Fly   417 ANYQMANMEQ-FVPKVREFIPE-RWLRDESNSHLVGETATPFMYLPFGFGPRSCAGKRIVDMMLE 479

  Fly   461 LLLARIFRSYRISTEARLE-----ELLVKGNISLKLK 492
            :.::|:.|:::|..:..:|     :..|:.||..|.|
  Fly   480 IAISRLVRNFKIGFDYPIENAFKAQFFVQPNIPFKFK 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 96/467 (21%)
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 102/492 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442750
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.