DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:539 Identity:137/539 - (25%)
Similarity:219/539 - (40%) Gaps:130/539 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLAWLYFL-------WSRRRY-YKVAWQLRG-----PIGW-PLIGMG----LQMMNPETFLQ-Y 56
            :||.||..|       |.|.:| |   ::.||     |..| |:..:|    |::...:.|.| |
  Fly     1 MLLIWLLLLTIVTLNFWLRHKYDY---FRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLY 62

  Fly    57 MDGLSRQFKAPFISWMGTSCF----LYINDPHSVEQIL--NSTHCTNKGDFYRFMSSAIGDGLFT 115
            .|..:.|.|.     :|...|    |.:.||..:.|:|  |..:..|     ||.|:..||.:..
  Fly    63 ADPRNGQAKI-----VGFFIFQTPALMVRDPELIRQVLIKNFNNFLN-----RFESADAGDPMGA 117

  Fly   116 SSSP-----RWHKHRRLINPAF--GRQ---ILSNFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQ 170
            .:.|     .|.:.|:.::..|  ||.   :.|..|.:.:...:.|.:||       |.|||   
  Fly   118 LTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKL-------GDRLE--- 172

  Fly   171 ILKKIVLEAACQTTMGKKMNFQHDGSLCIFKAYN------GLTEVCVK---------RMLSPWLY 220
              :.:.|...||.       :..|.:..:|.:.|      |.:|:..|         |.:..::.
  Fly   173 --RVLPLGRMCQL-------YTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMS 228

  Fly   221 PDLIYRRSGLFRLQQKVVGILFGFIEQLLEPIVSVVAANSNPDQQRSEMEMRGKSKAIFIEQVRE 285
            ...:.:.:|:  |:.||      |.|.....:..:|..:..|            :|...|.|::.
  Fly   229 VFFLPKWTGV--LKPKV------FTEDYARYMRHLVDDHHEP------------TKGDLINQLQH 273

  Fly   286 HVERGQLSWQD---------VRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLHKELVTEL 341
            .    |||...         |..:|.:.:.|.|||:|..:.||:..||..|..||:|..||....
  Fly   274 F----QLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF 334

  Fly   342 PPSGDINLEQLQRLEYTEMVINEAMRLFAPVPMVLR----SADQDIQLKRGDGEFLIPRGTQIGI 402
            ..:..::.:.|..|.|.:||..||:||:.....|.|    ||.:...| :...:|::|.|....|
  Fly   335 ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSL-QPHVDFIVPPGMPAYI 398

  Fly   403 DIYNMQRDERVWGPLSRTYNPDAHFGLDSPQR----HAFAFVPFTKGLRMCIGYRYAQMLMKLLL 463
            .|..:.||||.| |....::|: .||   |:|    |...::||..|...|||.|...:.:||.:
  Fly   399 SILGLHRDERFW-PEPCVFDPE-RFG---PERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGI 458

  Fly   464 ARIFRSYRIST-EARLEEL 481
            ..|.:.|.:.| |..:.|:
  Fly   459 VHILKQYWVETCERTVSEI 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 125/499 (25%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 126/503 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.