DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and Cyp26b1

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_851601.2 Gene:Cyp26b1 / 312495 RGDID:631379 Length:512 Species:Rattus norvegicus


Alignment Length:519 Identity:124/519 - (23%)
Similarity:216/519 - (41%) Gaps:107/519 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LASIILSGWLLLAWLYFLWSRRRYYKVAWQL-----------RGPIGWPLI---------GMGLQ 46
            ||:.::|..||||....||..|      |..           :|.:|:|||         |.|.|
  Rat    15 LAACLVSVTLLLAVSQQLWQLR------WAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQ 73

  Fly    47 MMNPETFLQYMDGLSRQFKA-----PFISWMGTSCFLYINDPHSVEQILNSTHCTNKGDFYRFMS 106
            ....|.:       ...||.     |.|...|.         .:|.:||...|.....::.|...
  Rat    74 SSRREKY-------GNVFKTHLLGRPLIRVTGA---------ENVRKILLGEHQLVSTEWPRSAR 122

  Fly   107 SAIGDGLFTSSSPRWHKH-RRLINPAFGRQILSNFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQ 170
            ..:|.....:|....|:: |::.:..|..:.|.::||    :.::::|..........:.:.:||
  Rat   123 VLLGPNTVANSIGDIHRNKRKVFSKIFSHEALESYLP----KIQLVIQDTLRAWSSQPEAINVYQ 183

  Fly   171 ILKKIVLEAACQTTMGKKMNFQHDGSLCIFKAYNGLTEVCVKRMLS-PWLYPDLIYRRSGLFRLQ 234
            ..:::....|.:..:|..:..:..|:|  |:.|    :..|:.:.| |...|...|||.    :|
  Rat   184 EAQRLTFRMAVRVLLGFSIPEEDLGNL--FEVY----QQFVENVFSLPVDLPFSGYRRG----IQ 238

  Fly   235 QKVVGILFGFIEQLLEPIVSVVAANSNPDQQRSEME-MRGKSKA----IFIEQVREHVERGQLSW 294
            .:.:      :::.||..:            |.::: .:||..:    |.||..:||.:  :::.
  Rat   239 ARQI------LQKGLEKAI------------REKLQCTQGKDYSDALDILIESSKEHGK--EMTM 283

  Fly   295 QDVRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLHKELVTE-------LPPSGDINLEQL 352
            |:::|.....|.|.:.||::|....|:.|..||...|||.:||..:       .|..|.:.|:.|
  Rat   284 QELKDGTLELIFAAYATTASASTSLIMQLLKHPAVLEKLREELRAQGLLHGGGCPCEGTLRLDML 348

  Fly   353 QRLEYTEMVINEAMRLFAPVPMVLRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPL 417
            ..|.|.:.||.|.||||.||....|:..|..:|   || |.||:|..:   :|:: ||.....|:
  Rat   349 SGLRYLDCVIKEVMRLFTPVSGGYRTVLQTFEL---DG-FQIPKGWSV---MYSI-RDTHDTAPV 405

  Fly   418 SR---TYNPDAHFGLDSPQRHA-FAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRISTEAR 477
            .:   .::||......|..:.. |.::||..|:|.|:|...|::.:|:|...:..:.|.....|
  Rat   406 FKDVNVFDPDRFSQARSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATR 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 112/472 (24%)
Cyp26b1NP_851601.2 CYP26B1 60..490 CDD:410730 108/468 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.