DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and Cyp4ae1

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_525044.1 Gene:Cyp4ae1 / 31193 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster


Alignment Length:468 Identity:128/468 - (27%)
Similarity:223/468 - (47%) Gaps:52/468 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QLRGPIGW--------PLIGMGLQM--MNPET----FLQYMDGLSRQFKAPFISWMGT---SCFL 78
            :||.|:..        ||:|...||  ..|:.    |.:|:....|.|       |||   ...:
  Fly    25 ELRHPLQGVVPSVSRVPLLGAAWQMRSFQPDNLHDKFAEYVKRFGRSF-------MGTVLGHVVM 82

  Fly    79 YINDPHSVEQILNSTHCTNKGDFYRFMSSAIGDGLFTSSSPRWHKHRRLINPAFGRQILSNFLPI 143
            ...:|..::.:|...|...||..|..:...:||||..|....||..|::|.|.|...||..|:.:
  Fly    83 VTAEPRHIDALLQGQHQLKKGTMYFALRGWLGDGLLLSRGKEWHTMRKIITPTFHFSILEQFVEV 147

  Fly   144 FNAEAEVLLQKLELEGVQHGKR-LEIYQILKKIVLEAACQTTMGKKMNFQHDGSLCIFKAYNGLT 207
            |:.::.:|:::|..  :.:|.. :.||.::....|:...:|.||..::.|...|. :..|...||
  Fly   148 FDRQSSILVERLRT--LSYGNEVVNIYPLVGLAALDIITETAMGVNVDAQGADSE-VVHAVKDLT 209

  Fly   208 EVCVKRMLSPWLYPDLIYR---RSGLFRLQQKVVGILFGFIEQLLEPIVSVVAANSNPDQQRSEM 269
            .:...|.:.|.|....::|   .|| ||.||..|..|..|...::|....::|..:|.|:..   
  Fly   210 NILATRFMRPHLLFPHLFRLCWPSG-FRKQQAGVICLHEFTNGIIEQRRRLLAREANQDKPT--- 270

  Fly   270 EMRGKSKAIFIEQVREHVERGQLSWQDVRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLH 334
                |..|:....:|..|:...|:.:.:|||.|..|....:||::|:.|.:..|:.|...|:||.
  Fly   271 ----KPHALLDTLLRATVDGQPLTDKQIRDEVNTFIFEGHDTTTSAVSFCLYLLSRHEAVQQKLF 331

  Fly   335 KELVTELPPSGD----INLEQLQRLEYTEMVINEAMRLFAPVPMVLRSADQDIQLKRGDGEFLIP 395
            :||  .:....|    :.|.....|.|...|:.|::||:.|:|.|.|..::|:.:..|    .||
  Fly   332 EEL--RMHYGQDLFRGVILSDFATLPYLSCVVKESLRLYPPIPAVARCLEKDLVIDEG----YIP 390

  Fly   396 RGTQIGIDIYNMQRDERVW-GPLSRTYNPDAHFGLDSPQRHAFAFVPFTKGLRMCIGYRYAQMLM 459
            .||.:.:.::.:.|||.:: .||  .:.|:.|.|.::|:...::::||:.|.|.|||.::|.:.|
  Fly   391 VGTNVVVLLWQLLRDEAIFTDPL--VFQPERHLGEEAPRLSPYSYIPFSAGPRNCIGQKFALLEM 453

  Fly   460 KLLLARIFRSYRI 472
            |.::.::.|.|::
  Fly   454 KTMVTKVIRHYQL 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 127/466 (27%)
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 125/458 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 1 0.950 - 0 Normalized mean entropy S4824
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
54.910

Return to query results.
Submit another query.