DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and Cyp4d2

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster


Alignment Length:475 Identity:129/475 - (27%)
Similarity:243/475 - (51%) Gaps:32/475 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLAWLYFLWSRRRYYKVAWQLRGPIGWPLIGMGLQM--MNPETFLQYMDGLSRQFKAPFISWMGT 74
            ||.| .||| |||...:   |.||...|.:|..|..  ::||..:.::....|::...:..|:..
  Fly    16 LLLW-DFLW-RRRGNGI---LPGPRPLPFLGNLLMYRGLDPEQIMDFVKKNQRKYGRLYRVWILH 75

  Fly    75 SCFLYINDPHSVEQILNSTHCTNKGDFYRFMSSAIGDGLFTSSSPRWHKHRRLINPAFGRQILSN 139
            ...::..||..:|.:|:|.....|.:.|:.::..:||||..|:..:||..|::|.|.|..:||..
  Fly    76 QLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGDGLLMSTGRKWHGRRKIITPTFHFKILEQ 140

  Fly   140 FLPIFNAEAEVLLQKLE--LEGVQHGKRLEIYQILKKIVLEAACQTTMGKKMNFQHDGSLCIFKA 202
            |:.||:.::.|::::|:  .:|:   ..:.|:.::....|:...:|.||.|:|.|.:.:|...:|
  Fly   141 FVEIFDQQSAVMVEQLQSRADGM---TPINIFPVICLTALDIIAETAMGTKINAQKNPNLPYVQA 202

  Fly   203 YNGLTEVCVKRMLSPWLYPDLIYR--RSGLFRLQQKVVGILFGFIEQLLEPIVSVVAANSNPDQQ 265
            .|.:|.:.:||.:..|...|.|:|  :....:.|.|.:.::..|.|.::......:..||.....
  Fly   203 VNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIKVMHDFTENIIRERRETLVNNSKETTP 267

  Fly   266 RSEMEMRGKSKAIFIEQV--REHVERGQLSWQDVRDEANVTIAATFETTSTALYFTILCLAMHPC 328
            ..|:...|:.:.:.:..|  :..::...||.:|:|:|.:..:....:||::|:.|.:..::.||.
  Fly   268 EEEVNFLGQKRRMALLDVLLQSTIDGAPLSDEDIREEVDTFMFEGHDTTTSAISFCLYEISRHPE 332

  Fly   329 YQEKLHKEL--VTELPPSGDINLEQLQRLEYTEMVINEAMRLFAPVPMVLRSADQDIQLKRGDGE 391
            .|::|.:|:  |........:.|..|..|::.|.||.|::||..||||:.|...:|::::   |:
  Fly   333 VQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESLRLHPPVPMIGRWFAEDVEIR---GK 394

  Fly   392 FLIPRGTQIGIDIYNMQRDERVWGPLSRTYNPD----AHFGLDSPQRHAFAFVPFTKGLRMCIGY 452
            . ||.||...:.|:.:.||...:      .:||    ..|..|.||.|.:|::||:.|.|.|||.
  Fly   395 H-IPAGTNFTMGIFVLLRDPEYF------ESPDEFRPERFDADVPQIHPYAYIPFSAGPRNCIGQ 452

  Fly   453 RYAQMLMKLLLARIFRSYRI 472
            ::|.:.||..::::.|.:.:
  Fly   453 KFAMLEMKSTVSKLLRHFEL 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 119/454 (26%)
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 119/454 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
54.970

Return to query results.
Submit another query.