DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP4A22

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:512 Identity:134/512 - (26%)
Similarity:229/512 - (44%) Gaps:52/512 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLAWLYFLWSRRRYYKVAWQLRG-------PIGWPLIGMGLQMMNPETFLQYMDGLSRQFKA-- 66
            ||:..|..:.:.:.|....|.|:.       |..| |.| .:|....:..||.:....:.|.:  
Human    24 LLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHW-LFG-HIQEFQHDQELQRIQERVKTFPSAC 86

  Fly    67 PFISWMGTSCFLYINDPHSVEQILNSTHCTNKGDFYRFMSSAIGDGLFTSSSPRWHKHRRLINPA 131
            |:..| |....:.:.||..::.||..:...:.|. |:|::..||.||...:...|.:|||::.||
Human    87 PYWIW-GGKVRVQLYDPDYMKVILGRSDPKSHGS-YKFLAPRIGYGLLLLNGQTWFQHRRMLTPA 149

  Fly   132 FGRQILSNFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQILKKIVLEAACQTTMGKKMNFQHDGS 196
            |...||..::.:......|:|.|.| |.:.....||::|.:..:.|:    |.|  |..|.|.||
Human   150 FHNDILKPYVGLMADSVRVMLDKWE-ELLGQDSPLEVFQHVSLMTLD----TIM--KSAFSHQGS 207

  Fly   197 LCI-------FKAYNGLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKVVGILFGFIEQLLEPIVS 254
            :.:       .:|.:.|..:....|.:.:...|.||..:...|...:...:.....:|       
Human   208 IQVDRNSQSYIQAISDLNSLVFCCMRNAFHENDTIYSLTSAGRWTHRACQLAHQHTDQ------- 265

  Fly   255 VVAANSNPDQQRSEME-MRGKSKAIFIE-QVREHVERGQ-LSWQDVRDEANVTIAATFETTSTAL 316
            |:.......|:..|:| ::.|....|:: .:...:|.|. ||.:|:|.|.:..:....:||::.:
Human   266 VIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGI 330

  Fly   317 YFTILCLAMHPCYQEKLHKELVTELPPSGDINLEQLQRLEYTEMVINEAMRLFAPVPMVLRSADQ 381
            .:.:..||.||.:||:..:|:...|.....|....|.::.||.|.|.||:||:.|||.:.|....
Human   331 SWILYALATHPKHQERCREEIHGLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELST 395

  Fly   382 DIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRTYNPDAHFGLDSPQRHAFAFVPFTKGL 446
            .:...  ||..| |:|..:.:.||.:..:.:|| |....::| :.|...|.| |:.||:||:.|.
Human   396 PVTFP--DGRSL-PKGIMVLLSIYGLHHNPKVW-PNLEVFDP-SRFAPGSAQ-HSHAFLPFSGGS 454

  Fly   447 RMCIGYRYAQMLMKLLLARIFRSYRISTE--------ARLEELLVKGNISLKLKDYP 495
            |.|||.::|...:|:..|.....:.:..:        ||| .|..|..|.|:|:..|
Human   455 RNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIPMARL-VLKSKNGIHLRLRRLP 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 119/459 (26%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 125/477 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.