DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and CYP4X1

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:500 Identity:113/500 - (22%)
Similarity:216/500 - (43%) Gaps:61/500 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AWLYFLWSRRRYYKVAWQL-------------------------RGPIGWPLIGMGLQMMNPETF 53
            :||...|:|..|....:.|                         ..|..|.|   |.|....:..
Human     4 SWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFL---GHQKFIQDDN 65

  Fly    54 LQYMDGLSRQFKAPFISWMGT-SCFLYINDPHSVEQILNSTHCTNKGDF-YRFMSSAIGDGLFTS 116
            ::.::.:..::...|..|:|. ..|..|.||...:.:|:.|  ..|..: .:|....:|.||...
Human    66 MEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRT--DPKSQYLQKFSPPLLGKGLAAL 128

  Fly   117 SSPRWHKHRRLINPAFGRQILSNFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQILKKIVLEAAC 181
            ..|:|.:||||:.|.|...||..::.:.....:::|.|.|.........:|:|:.:..:.|:...
Human   129 DGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIM 193

  Fly   182 QTTMGKKMNFQ----HDGSLCIFKAYNGLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKVVGILF 242
            :....|:.|.|    ||.   ..||...|:::...|:.|...:.|:|::.|......||:..:|.
Human   194 KCAFSKETNCQTNSTHDP---YAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLN 255

  Fly   243 GFIEQLLE----PIVSVVAANSNPDQQRSEMEMRGKSKAIFIEQVREHVERGQLSWQ--DVRDEA 301
            .:.:.:::    .:.:.|..::.|.::..:          |::.|....:....|:.  ||..|.
Human   256 QYTDTIIQERKKSLQAGVKQDNTPKRKYQD----------FLDIVLSAKDESGSSFSDIDVHSEV 310

  Fly   302 NVTIAATFETTSTALYFTILCLAMHPCYQEKLHKELVTELPPSGDINLEQLQRLEYTEMVINEAM 366
            :..:.|..:|.:.::.:.:.|||::|.:||:..:|:...|.....|..:||..:.||.|.|.|..
Human   311 STFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQLGEMSYTTMCIKETC 375

  Fly   367 RLFAPVPMVLRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVW-GPLSRTYNPDAHFGLD 430
            ||...||.:.|...:.:....|   ..:|.|..:.:.|:.:..:..|| .|  :.::|......:
Human   376 RLIPAVPSISRDLSKPLTFPDG---CTLPAGITVVLSIWGLHHNPAVWKNP--KVFDPLRFSQEN 435

  Fly   431 SPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRISTE 475
            |.|||.:|::||:.|.|.|||..:|.:.:|:.:|.|...:|::.:
Human   436 SDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 107/453 (24%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 107/456 (23%)
heme binding region 447..460 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.