DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313b1 and Cyp19a1

DIOPT Version :9

Sequence 1:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_058781.2 Gene:Cyp19a1 / 25147 RGDID:2457 Length:503 Species:Rattus norvegicus


Alignment Length:484 Identity:117/484 - (24%)
Similarity:202/484 - (41%) Gaps:102/484 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PFIS-----WM--GTSCFLYINDPHSVEQILNSTHCTNK--GDFYRFMSSAIGDGLFTSSSPRWH 122
            |.||     ||  |::|..|                 ||  |:|.|...|.....:.:.||...|
  Rat    58 PLISHGRFLWMGIGSACNYY-----------------NKMYGEFMRVWISGEETLIISKSSSMVH 105

  Fly   123 --KHRRLI-----------------------NPAFGRQILSNFLPIFNAEAEVLLQKLELEGV-Q 161
              ||...|                       ||:..|.:...|:........:.:.::.:|.: |
  Rat   106 VMKHSNYISRFGSKRGLQCIGMHENGIIFNNNPSLWRTVRPFFMKALTGPGLIRMVEVCVESIKQ 170

  Fly   162 HGKRL----------EIYQILKKIVLEAACQTTMGKKMNFQHDGSLCIFKA---YNGLTEVCVKR 213
            |..||          ::..:::.|:|:.:....:|..:    |.|..:.|.   :|....:.:| 
  Rat   171 HLDRLGDVTDNSGYVDVVTLMRHIMLDTSNTLFLGIPL----DESSIVKKIQGYFNAWQALLIK- 230

  Fly   214 MLSPWLYPDLIYRRSGLFRLQQKVVGILFGFIEQLLEPIVSVVAANSNPDQQRSEMEMRGKSKAI 278
                   |::.::.|.|:|..::.|..|...||.|:|.....|::     .::.|..|...:..|
  Rat   231 -------PNIFFKISWLYRKYERSVKDLKDEIEILVEKKRQKVSS-----AEKLEDCMDFATDLI 283

  Fly   279 FIEQVREHVERGQLSWQDVRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLHKELVTELPP 343
            |.|:      ||.|:.::|.......:.|..:|.|..||..:|.:|.:|..:..:.||:.| :..
  Rat   284 FAER------RGDLTKENVNQCILEMLIAAPDTMSVTLYVMLLLIAEYPEVETAILKEIHT-VVG 341

  Fly   344 SGDINLEQLQRLEYTEMVINEAMRLFAPVPMVLRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQ 408
            ..||.:..:|.|:..|..|||::|....|.:|:|.|.:|..:   || :.:.:||.|.::|..|.
  Rat   342 DRDIRIGDVQNLKVVENFINESLRYQPVVDLVMRRALEDDVI---DG-YPVKKGTNIILNIGRMH 402

  Fly   409 RDERVWGPLSRTYNPDAHFGLDSPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRIS 473
            |.|....|...|..   :|..:.|.|:   |.||..|.|.|.|...|.::||::|..:.:.:.:.
  Rat   403 RLEYFPKPNEFTLE---NFEKNVPYRY---FQPFGFGPRSCAGKYIAMVMMKVVLVTLLKRFHVK 461

  Fly   474 T-EARLEELLVKGN-ISLKL-KDYPLCRV 499
            | :.|..|.:.|.| :||.| :|.|:..:
  Rat   462 TLQKRCIENMPKNNDLSLHLDEDSPIVEI 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 107/454 (24%)
Cyp19a1NP_058781.2 CYP19A1 72..485 CDD:410709 109/463 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.